Recombinant Human HYKK Protein, GST-tagged

• Cat.No.: HYKK-5217H
• Product Overview: Human HYKK full-length ORF ( ENSP00000353710, 1 a.a. - 172 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: HYKK (Hydroxylysine Kinase) is a Protein Coding gene. Diseases associated with HYKK include Nicotine Dependence, Protection Against. Among its related pathways are Lysine degradation and Viral mRNA Translation. GO annotations related to this gene include transferase activity, transferring phosphorus-containing groups and hydroxylysine kinase activity.
• Molecular Mass: 45.2 kDa
• AA Sequence: MSSGNYQQSEALSKPTFSEEQASALVESVFGLKVSKVRPLPSYDDQNFHVYVSKTKDGPTEYVLKISNTKASKNPDLIEVQNHIIMFLKAAGFPTASVCHTKGDNTASLVSVDSGSEIKSYLVRLLTYLPGRPIAELPVSPQLLYEIGKLAAKLDKTLQEGKPRVTPLLAKN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HYKK hydroxylysine kinase [ Homo sapiens (human) ]
• Official Symbol: HYKK
• Synonyms: HYKK; hydroxylysine kinase; AGPHD1; Hydroxylysine Kinase; Aminoglycoside Phosphotransferase Domain-Containing Protein 1; 5-Hydroxy-L-Lysine Kinase; 5-Hydroxylysine Kinase; Aminoglycoside Phosphotransferase Domain Containing 1; EC 2.7.1.81; hydroxylysine kinase; 5-hydroxy-L-lysine kinase; 5-hydroxylysine kinase; aminoglycoside phosphotransferase domain-containing protein 1
• Gene ID: 123688
• mRNA Refseq: NM_001013619
• Protein Refseq: NP_001013641
• MIM: 614681
• UniProt ID: A2RU49