Recombinant Human HTR2C

• Cat.No.: HTR2C-26028TH
• Product Overview: Recombinant fragment of Human 5HT2C Receptor with N terminal proprietary tag, 31.35kDa.

Specification

• Description: Serotonin (5-hydroxytryptamine, 5-HT), a neurotransmitter, elicits a wide array of physiological effects by binding to several receptor subtypes, including the 5-HT2 family of seven-transmembrane-spanning, G-protein-coupled receptors, which activate phospholipase C and D signaling pathways. This gene encodes the 2C subtype of serotonin receptor and its mRNA is subject to multiple RNA editing events, where genomically encoded adenosine residues are converted to inosines. RNA editing is predicted to alter amino acids within the second intracellular loop of the 5-HT2C receptor and generate receptor isoforms that differ in their ability to interact with G proteins and the activation of phospholipase C and D signaling cascades, thus modulating serotonergic neurotransmission in the central nervous system. Studies in humans have reported abnormalities in patterns of 5-HT2C editing in depressed suicide victims.
• Protein length: 52 amino acids
• Molecular Weight: 31.350kDa inclusive of tags
• Source: Wheat germ
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MVNLRNAVHSFLVHLIGLLVWQCDISVSPVAAIVTDIFNTSDGGRFKFPDGV
• Sequence Similarities: Belongs to the G-protein coupled receptor 1 family.
• Tag: Non

Gene Information

• Gene Name: HTR2C 5-hydroxytryptamine (serotonin) receptor 2C [ Homo sapiens ]
• Official Symbol: HTR2C
• Synonyms: HTR2C; 5-hydroxytryptamine (serotonin) receptor 2C; HTR1C; 5-hydroxytryptamine receptor 2C; 5 HT2C
• Gene ID: 3358
• mRNA Refseq: NM_000868
• Protein Refseq: NP_000859
• MIM: 312861
• Uniprot ID: P28335
• Chromosome Location: Xq23
• Pathway: Amine ligand-binding receptors, organism-specific biosystem; Calcium signaling pathway, organism-specific biosystem; Calcium signaling pathway, conserved biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (q) signalling events, organism-specific biosystem
• Function: 1-(4-iodo-2,5-dimethoxyphenyl)propan-2-amine binding; G-protein coupled receptor activity; drug binding; phosphatidylinositol phospholipase C activity; receptor activity