Recombinant Human HTR1F Protein, GST-tagged

• Cat.No.: HTR1F-5245H
• Product Overview: Human HTR1F partial ORF ( NP_000857, 203 a.a. - 279 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: HTR1F (5-Hydroxytryptamine Receptor 1F) is a Protein Coding gene. Diseases associated with HTR1F include Migraine With Or Without Aura 1. Among its related pathways are Serotonergic synapse and Peptide ligand-binding receptors. GO annotations related to this gene include G-protein coupled receptor activity and serotonin binding. An important paralog of this gene is HTR1E.
• Molecular Mass: 34.21 kDa
• AA Sequence: KIYRAAKTLYHKRQASRIAKEEVNGQVLLESGEKSTKSVSTSYVLEKSLSDPSTDFDKIHSTVRSLRSEFKHEKSWR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HTR1F 5-hydroxytryptamine (serotonin) receptor 1F, G protein-coupled [ Homo sapiens ]
• Official Symbol: HTR1F
• Synonyms: HTR1F; 5-hydroxytryptamine (serotonin) receptor 1F, G protein-coupled; 5 hydroxytryptamine (serotonin) receptor 1F; 5-hydroxytryptamine receptor 1F; 5 HT1F; HTR1EL; serotonin receptor 1F; 5HT6; MR77; 5-HT1F; 5-HT-1F
• Gene ID: 3355
• mRNA Refseq: NM_000866
• Protein Refseq: NP_000857
• MIM: 182134
• UniProt ID: P30939