Recombinant Human HTR1B Protein, GST-tagged

Cat.No. : HTR1B-5251H
Product Overview : Human HTR1B partial ORF ( NP_000854, 1 a.a. - 49 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The neurotransmitter serotonin (5-hydroxytryptamine; 5-HT) exerts a wide variety of physiologic functions through a multiplicity of receptors and may be involved in human neuropsychiatric disorders such as anxiety, depression, or migraine. These receptors consist of 4 main groups, 5-HT-1, 5-HT-2, 5-HT-3, and 5-HT4, subdivided into several distinct subtypes on the basis of their pharmacologic characteristics, coupling to intracellular second messengers, and distribution within the nervous system (Zifa and Fillion, 1992 [PubMed 1359584]). The serotonergic receptors belong to the multigene family of receptors coupled to guanine nucleotide-binding proteins.[supplied by OMIM
Molecular Mass : 31.13 kDa
AA Sequence : MEEPGAQCAPPPPAGSETWVPQANLSSAPSQNCSAKDYIYQDSISLPWK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HTR1B 5-hydroxytryptamine (serotonin) receptor 1B, G protein-coupled [ Homo sapiens ]
Official Symbol HTR1B
Synonyms HTR1B; 5-hydroxytryptamine (serotonin) receptor 1B, G protein-coupled; 5 hydroxytryptamine (serotonin) receptor 1B; 5-hydroxytryptamine receptor 1B; 5 HT1B; 5 HT1DB; HTR1D2; S12; 5-HT-1B; 5-HT-1D-beta; serotonin receptor 1B; serotonin 1D beta receptor; 5-HT1B; HTR1DB; 5-HT1DB;
Gene ID 3351
mRNA Refseq NM_000863
Protein Refseq NP_000854
MIM 182131
UniProt ID P28222

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All HTR1B Products

Required fields are marked with *

My Review for All HTR1B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon