Recombinant Human HTR1B Protein, GST-tagged

• Cat.No.: HTR1B-5251H
• Product Overview: Human HTR1B partial ORF ( NP_000854, 1 a.a. - 49 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The neurotransmitter serotonin (5-hydroxytryptamine; 5-HT) exerts a wide variety of physiologic functions through a multiplicity of receptors and may be involved in human neuropsychiatric disorders such as anxiety, depression, or migraine. These receptors consist of 4 main groups, 5-HT-1, 5-HT-2, 5-HT-3, and 5-HT4, subdivided into several distinct subtypes on the basis of their pharmacologic characteristics, coupling to intracellular second messengers, and distribution within the nervous system (Zifa and Fillion, 1992 [PubMed 1359584]). The serotonergic receptors belong to the multigene family of receptors coupled to guanine nucleotide-binding proteins.[supplied by OMIM
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 31.13 kDa
• AA Sequence: MEEPGAQCAPPPPAGSETWVPQANLSSAPSQNCSAKDYIYQDSISLPWK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HTR1B 5-hydroxytryptamine (serotonin) receptor 1B, G protein-coupled [ Homo sapiens ]
• Official Symbol: HTR1B
• Synonyms: HTR1B; 5-hydroxytryptamine (serotonin) receptor 1B, G protein-coupled; 5 hydroxytryptamine (serotonin) receptor 1B; 5-hydroxytryptamine receptor 1B; 5 HT1B; 5 HT1DB; HTR1D2; S12; 5-HT-1B; 5-HT-1D-beta; serotonin receptor 1B; serotonin 1D beta receptor; 5-HT1B; HTR1DB; 5-HT1DB
• Gene ID: 3351
• mRNA Refseq: NM_000863
• Protein Refseq: NP_000854
• MIM: 182131
• UniProt ID: P28222