Recombinant Human HTATIP2 Protein, GST-tagged

• Cat.No.: HTATIP2-5256H
• Product Overview: Human HTATIP2 full-length ORF ( AAH02439, 1 a.a. - 242 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: HTATIP2 (HIV-1 Tat Interactive Protein 2) is a Protein Coding gene. Diseases associated with HTATIP2 include Hiv-1 and Gnathodiaphyseal Dysplasia. Among its related pathways are Apoptosis and Autophagy and Cytoskeletal Signaling. GO annotations related to this gene include oxidoreductase activity and NAD binding.
• Molecular Mass: 52.36 kDa
• AA Sequence: MAETEALSKLREDFRMQNKSVFILGASGETGRVLLKEILEQGLFSKVTLIGRRKLTFDEEAYKNVNQEVVDFEKLDDYASAFQGHDVGFCCLGTTRGKAGAEGFVRVDRDYVLKSAELAKAGGCKHFNLLSSKGADKSSNFLYLQVKGEVEAKVEELKFDRYSVFRPGVLLCDRQESRPGEWLVRKFFGSLPDSWARGHSVPVVTVVRAMLNNVVRPRDKQMELLENKAIHDLGKAHGSLKP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HTATIP2 HIV-1 Tat interactive protein 2, 30kDa [ Homo sapiens ]
• Official Symbol: HTATIP2
• Synonyms: HTATIP2; HIV-1 Tat interactive protein 2, 30kDa; HIV 1 Tat interactive protein 2, 30 kDa; oxidoreductase HTATIP2; CC3; FLJ26963; SDR44U1; short chain dehydrogenase/reductase family 44U; member 1; Tat interacting protein (30kD); TIP30; Tat-interacting protein (30kD); HIV-1 TAT-interactive protein 2; 30 kDa HIV-1 TAT-interacting protein; short chain dehydrogenase/reductase family 44U, member 1
• Gene ID: 10553
• mRNA Refseq: NM_001098520
• Protein Refseq: NP_001091990
• MIM: 605628
• UniProt ID: Q9BUP3