Recombinant Human HSPB7, His-tagged

• Cat.No.: HSPB7-26656TH
• Product Overview: Recombinant full length Human cvHSP with an N-terminal His tag; predicted MWt 20.7 kDa including the tag.

Specification

• Description: HSPB7 is a member of HSPB (Heat shock protein beta) family. The HSPB family is one of the more diverse families within the group of HSP families. Some members have chaperone-like activities and/or play a role in cytoskeletal stabilization.
• Protein length: 170 amino acids
• Conjugation: HIS
• Molecular Weight: 20.700kDa inclusive of tags
• Source: E. coli
• Tissue specificity: Isoform 1 is highly expressed in adult and fetal heart, skeletal muscle, and at a much lower levels in adipose tissue and in aorta. Undetectable in other tissues. Isoform 2 and isoform 3 are poorly detected in heart.
• Form: Liquid
• Purity: by SDS-PAGE
• Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 1.17% Sodium chloride, 0.03% DTT, 50% Glycerol
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMSHRTSSTFRAERSFHSSSS SSSSSTSSSASRALPAQDPPMEKALSMFSDDFGSFMRPHS EPLAFPARPGGAGNIKTLGDAYEFAVDVRDFSPEDIIVTT SNNHIEVRAEKLAADGTVMNTFAHKCQLPEDVDPTSVTSA LREDGSLTIRARRHPHTEHVQQTFRTEIKI
• Sequence Similarities: Belongs to the small heat shock protein (HSP20) family.

Gene Information

• Gene Name: HSPB7 heat shock 27kDa protein family, member 7 (cardiovascular) [ Homo sapiens ]
• Official Symbol: HSPB7
• Synonyms: HSPB7; heat shock 27kDa protein family, member 7 (cardiovascular); heat shock 27kD protein family, member 7 (cardiovascular); heat shock protein beta-7; cvHSP
• Gene ID: 27129
• mRNA Refseq: NM_014424
• Protein Refseq: NP_055239
• MIM: 610692
• Uniprot ID: Q9UBY9
• Chromosome Location: 1p36.23-p34.3
• Function: protein C-terminus binding; protein binding