Recombinant Human HSPB11, His-tagged

• Cat.No.: HSPB11-27166TH
• Product Overview: Recombinant full length Human C1orf41 with an N terminal His tag; 164 amino acids, predicted MWt 18.5kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 144 amino acids
• Description: HSPCO34 protein, chromosome 1 open reading frame 41.
• Conjugation: HIS
• Molecular Weight: 18.500kDa inclusive of tags
• Tissue specificity: Detected in placenta.
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 2mM DTT, pH 8.0
• Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMRKIDLCLSSEGSEVILATSSDEKHPPENIIDGNPETFWTTTGMFPQEFIICFHKHVRIERLVIQSYFVQTLKIEKSTSKEPVDFEQWIEKDLVHTEGQLQNEEIVAHDGSATYLRFIIVSAFDHFASVHSVSAEGTVVSNLSS

Gene Information

• Gene Name: HSPB11 heat shock protein family B (small), member 11 [ Homo sapiens ]
• Official Symbol: HSPB11
• Synonyms: HSPB11; heat shock protein family B (small), member 11; C1orf41, chromosome 1 open reading frame 41; heat shock protein beta-11; HSPCO34; IFT25; intraflagellar transport 25 homolog (Chlamydomonas); PP25
• Gene ID: 51668
• mRNA Refseq: NM_016126
• Protein Refseq: NP_057210
• Uniprot ID: Q9Y547
• Chromosome Location: 1p32