Recombinant Human HSPA6 Protein, GST-tagged

• Cat.No.: HSPA6-5110H
• Product Overview: Human HSPA6 partial ORF ( NP_002146.2, 544 a.a. - 643 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: HSPA6 (Heat Shock Protein Family A (Hsp70) Member 6) is a Protein Coding gene. Among its related pathways are mRNA Splicing - Major Pathway and Proteolysis Role of Parkin in the Ubiquitin-Proteasomal Pathway. GO annotations related to this gene include enzyme binding and heat shock protein binding. An important paralog of this gene is HSPA1B.
• Molecular Mass: 36.74 kDa
• AA Sequence: LEAHVFHVKGSLQEESLRDKIPEEDRRKMQDKCREVLAWLEHNQLAEKEEYEHQKRELEQICRPIFSRLYGGPGVPGGSSCGTQARQGDPSTGPIIEEVD
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HSPA6 heat shock 70kDa protein 6 (HSP70B) [ Homo sapiens ]
• Official Symbol: HSPA6
• Synonyms: HSPA6; heat shock 70kDa protein 6 (HSP70B); heat shock 70kD protein 6 (HSP70B); heat shock 70 kDa protein 6; heat shock 70 kDa protein B
• Gene ID: 3310
• mRNA Refseq: NM_002155
• Protein Refseq: NP_002146
• MIM: 140555
• UniProt ID: P17066