Recombinant Human HSP90AA1 protein, His-tagged

Cat.No. : HSP90AA1-02H
Product Overview : Recombinant partial human HSP90AA1 was expressed in E. coli using an N-terminal 6xHis-tagged.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 233-291aa
Description : The protein encoded by this gene is an inducible molecular chaperone that functions as a homodimer. The encoded protein aids in the proper folding of specific target proteins by use of an ATPase activity that is modulated by co-chaperones. Two transcript variants encoding different isoforms have been found for this gene.
Form : Liquid or Lyophilized powder
Molecular Mass : 11.2 kDa
AA Sequence : DEAEEKEDKEEEKEKEEKESEDKPEIEDVGSDEEEEKKDGDKKKKKKIKEKYIDQEELN
Purity : Greater than 85% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : Store at -20 centigrade/-80 centigrade upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Expiry : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Storage Buffer : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 centigrade/-80 centigrade. Our default final concentration of glycerol is 50%.
Gene Name HSP90AA1 heat shock protein 90 alpha family class A member 1 [ Homo sapiens (human) ]
Official Symbol HSP90AA1
Synonyms Heat shock 86 kDa; Heat shock protein 90kDa alpha cytosolic class A member 1; Heat shock protein 90kDa alpha cytosolic class B member 1; Heat shock protein HSP 90 alpha; Heat shock protein HSP 90 beta; Heat shock protein HSP 90-alpha; HS90A_HUMAN; HSP 84; HSP 86; Hsp 90; HSP86; HSP90A; HSP90AA1; HSP90AB1; HSP90B; HSPC1; HSPC2; HSPCAL1; HSPCAL4; Renal carcinoma antigen NY-REN-38.
Gene ID 3320
mRNA Refseq NM_001017963
Protein Refseq NP_001017963
MIM 140571
UniProt ID P07900

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All HSP90AA1 Products

Required fields are marked with *

My Review for All HSP90AA1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon