Recombinant Human HSF1 protein, Arginine-tagged
Cat.No. : | HSF1-205H |
Product Overview : | Recombinant human HSF1 protein fused with 11 arginine domain at C-terminal which efficiently delivery protein intracellularly, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 1-529 a.a. |
Form : | 0.2 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | 29aa_Tag_DLPVGPGAAGPSNVPAFLTKLWTLVSDPDTDALICWSPSGNSFHVFDQGQFAKEVLPKYFKHNNMA SFVRQLNMYGFRKVVHIEQGGLVKPERDDTEFQHPCFLRGQEQLLENIKRKVTSVSTLKSEDIKIRQDSVTKLLT DVQLMKGKQECMDSKLLAMKHENEALWREVASLRQKHAQQQKVVNKLIQFLISLVQSNRILGVKRKIPLMLNDSG SAHSMPKYSRQFSLEHVHGSGPYSAPSPAYSSSSLYAPDAVASSGPIISDITELAPASPMASPGGSIDERPLSSS PLVRVKEEPPSPPQSPRVEEASPGRPSSVDTLLSPTALIDSILRESEPAPASVTALTDARGHTDTEGRPPSPPPT STPEKCLSVACLDKNELSDHLDAMDSNLDNLQTMLSSHGFSVDTSALLDLFSPSVTVPDMSLPDLDSSLASIQEL LSPQEPPRPPEAENSSPDSGKQLVHYTAQPLFLLDPGSVDTGSNDLPVLFELGEGSYFSEGDGFAEDPTISLLTG SEPPKAKDPTVSLEESGGGGSPGRRRRRRRRRRR |
Purity : | >90% by SDS-PAGE |
Applications : | 1. Protein transduction for study of hepatocytes cell metabolic pathway regulation.2. Active recombinant protein, may be used for ELISA based DNA/Protein binding assay.3. As specific protein substrate for kinase assay.4. As immunogen for specific antibody production. |
Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
Gene Name | HSF1 heat shock transcription factor 1 [ Homo sapiens ] |
Official Symbol | HSF1 |
Synonyms | HSF1; heat shock transcription factor 1; heat shock factor protein 1; HSTF1; HSF 1; HSTF 1; |
Gene ID | 3297 |
mRNA Refseq | NM_005526 |
Protein Refseq | NP_005517 |
MIM | 140580 |
UniProt ID | Q00613 |
Chromosome Location | 8q24.3 |
Pathway | Legionellosis, organism-specific biosystem; Legionellosis, conserved biosystem; |
Function | protein binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; |
◆ Recombinant Proteins | ||
Hsf1-1183M | Recombinant Mouse Hsf1 Protein, MYC/DDK-tagged | +Inquiry |
HSF1-5085H | Recombinant Human HSF1 Protein, GST-tagged | +Inquiry |
HSF1-13969H | Recombinant Human HSF1, GST-tagged | +Inquiry |
HSF1-327H | Recombinant Human Heat Shock Transcription Factor 1, His-tagged | +Inquiry |
HSF1-9140Z | Recombinant Zebrafish HSF1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
HSF1-339HCL | Recombinant Human HSF1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HSF1 Products
Required fields are marked with *
My Review for All HSF1 Products
Required fields are marked with *
0
Inquiry Basket