Recombinant Human HSD17B6 Protein, GST-tagged

• Cat.No.: HSD17B6-5072H
• Product Overview: Human HSD17B6 full-length ORF ( AAH20710, 1 a.a. - 317 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The protein encoded by this gene has both oxidoreductase and epimerase activities and is involved in androgen catabolism. The oxidoreductase activity can convert 3 alpha-adiol to dihydrotestosterone, while the epimerase activity can convert androsterone to epi-androsterone. Both reactions use NAD+ as the preferred cofactor. This gene is a member of the retinol dehydrogenase family. Transcript variants utilizing alternative polyadenylation signals exist. [provided by RefSeq
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 60.61 kDa
• AA Sequence: MWLYLAAFVGLYYLLHWYRERQVVSHLQDKYVFITGCDSGFGNLLARQLDARGLRVLAACLTEKGAEQLRGQTSDRLETVTLDVTKMESIAAATQWVKEHVGDRGLWGLVNNAGILTPITLCEWLNTEDSMNMLKVNLIGVIQVTLSMLPLVRRARGRIVNVSSILGRVAFFVGGYCVSKYGVEAFSDILRREIQHFGVKISIVEPGYFRTGMTNMTQSLERMKQSWKEAPKHIKETYGQQYFDALYNIMKEGLLNCSTNLNLVTDCMEHALTSVHPRTRYSAGWDAKFFFIPLSYLPTSLADYILTRSWPKPAQAV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HSD17B6 hydroxysteroid (17-beta) dehydrogenase 6 homolog (mouse) [ Homo sapiens ]
• Official Symbol: HSD17B6
• Synonyms: HSD17B6; hydroxysteroid (17-beta) dehydrogenase 6 homolog (mouse); hydroxysteroid (17 beta) dehydrogenase 6; 17-beta-hydroxysteroid dehydrogenase type 6; 3(alpha >beta) hydroxysteroid epimerasel; 3 hydroxysteroid epimerase; HSE; NAD+ dependent 3 alpha hydroxysteroid dehydrogenase; oxidative 3 alpha hydroxysteroid dehydrogenase; oxidoreductase; retinol dehydrogenase; RODH; SDR9C6; short chain dehydrogenase/reductase family 9C; member 6; 17-beta-HSD6; 17-beta-HSD 6; 3-alpha-> beta-HSE; 3-hydroxysteroid epimerase; beta-hydroxysteroid epimerase; 3(alpha-> beta)-hydroxysteroid epimerase; beta)-hydroxysteroid epimerasel; oxidative 3-alpha hydroxysteroid dehydrogenase; oxidative 3-alpha-hydroxysteroid-dehydrogenase; short chain dehydrogenase/reductase family 9C, member 6; NAD+ -dependent 3 alpha-hydroxysteroid dehydrogenase 3-hydroxysteroid epimerase
• Gene ID: 8630
• mRNA Refseq: NM_003725
• Protein Refseq: NP_003716
• MIM: 606623
• UniProt ID: O14756