Recombinant Human HSD17B4, His-tagged
Cat.No. : | HSD17B4-109H |
Product Overview : | Recombinant Human Peroxisomal Multifunctional Enzyme Type 2/HSD17B4 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Gly2-Leu736) of Human HSD17B4 fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 2-736 a.a. |
Description : | Peroxisomal Multifunctional Enzyme Type 2 (MFE-2) belongs to the short-chain dehydrogenase/reductase (SDR) family. MFE-2 localizes to the peroxisome and contains one MaoC-like domain and one SCP2 domain. MFE-2 can be cleaved into (3R)-hydroxyacyl-CoA dehydrogenase and Enoyol-CoA hydratase 2 chains. MFE-2 acts as a bifunctional enzyme acting on the peroxisomal beta-oxidation pathway for fatty acids. It catalyzes the formation of 3-ketoacyl-CoA intermediates from both straight-chain and 2-methyl-branched-chain fatty acids. Defects in MFE-2 are a cause of D-bifunctional protein deficiency, which is a disorder of peroxisomal fatty acid β-oxidation. |
AA Sequence : | MGSPLRFDGRVVLVTGAGAGLGRAYALAFAERGALVVVNDLGGDFKGVGKGSLAADKVVEEIRRR GGKAVANYDSVEEGEKVVKTALDAFGRIDVVVNNAGILRDRSFARISDEDWDIIHRVHLRGSFQV TRAAWEHMKKQKYGRIIMTSSASGIYGNFGQANYSAAKLGLLGLANSLAIEGRKSNIHCNTIAPN AGSRMTQTVMPEDLVEALKPEYVAPLVLWLCHESCEENGGLFEVGAGWIGKLRWERTLGAIVRQK NHPMTPEAVKANWKKICDFENASKPQSIQESTGSIIEVLSKIDSEGGVSANHTSRATSTATSGFA GAIGQKLPPFSYAYTELEAIMYALGVGASIKDPKDLKFIYEGSSDFSCLPTFGVIIGQKSMMGGG LAEIPGLSINFAKVLHGEQYLELYKPLPRAGKLKCEAVVADVLDKGSGVVIIMDVYSYSEKELIC HNQFSLFLVGSGGFGGKRTSDKVKVAVAIPNRPPDAVLTDTTSLNQAALYRLSGDWNPLHIDPNF ASLAGFDKPILHGLCTFGFSARRVLQQFADNDVSRFKAIKARFAKPVYPGQTLQTEMWKEGNRIH FQTKVQETGDIVISNAYVDLAPTSGTSAKTPSEGGKLQSTFVFEEIGRRLKDIGPEVVKKVNAVF EWHITKGGNIGAKWTIDLKSGSGKVYQGPAKGAADTTIILSDEDFMEVVLGKLDPQKAFFSGRLK ARGNIMLSQKLQMILKDYAKLVDHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Gene Name | HSD17B4 hydroxysteroid (17-beta) dehydrogenase 4 [ Homo sapiens ] |
Official Symbol | HSD17B4 |
Synonyms | HSD17B4; hydroxysteroid (17-beta) dehydrogenase 4; peroxisomal multifunctional enzyme type 2; 3 alpha; 7 alpha; 12 alpha trihydroxy 5 beta cholest 24 enoyl CoA hydratase; 17 beta HSD IV; 17 beta hydroxysteroid dehydrogenase 4; 17beta estradiol dehydrogenase type IV; beta hydroxyacyl dehydrogenase; beta keto reductase; D 3 hydroxyacyl CoA dehydratase; D bifunctional protein; peroxisomal; DBP; MFE 2; peroxisomal multifunctional protein 2; SDR8C1; short chain dehydrogenase/reductase family 8C; member 1; 17-beta-HSD 4; 17-beta-HSD IV; beta-keto-reductase; multifunctional protein 2; beta-hydroxyacyl dehydrogenase; D-3-hydroxyacyl-CoA dehydratase; D-bifunctional protein, peroxisomal; 17-beta-hydroxysteroid dehydrogenase 4; 17beta-estradiol dehydrogenase type IV; short chain dehydrogenase/reductase family 8C, member 1; 3-alpha,7-alpha,12-alpha-trihydroxy-5-beta-cholest-24-enoyl-CoA hydratase; MFE-2; MPF-2; |
Gene ID | 3295 |
mRNA Refseq | NM_000414 |
Protein Refseq | NP_000405 |
MIM | 601860 |
UniProt ID | P51659 |
Chromosome Location | 5q2 |
Pathway | Beta-oxidation of pristanoyl-CoA, organism-specific biosystem; Beta-oxidation of very long chain fatty acids, organism-specific biosystem; Bile acid and bile salt metabolism, organism-specific biosystem; Bile acid biosynthesis, cholesterol => cholate, organism-specific biosystem; Bile acid biosynthesis, cholesterol => cholate, conserved biosystem; |
Function | 3-hydroxyacyl-CoA dehydrogenase activity; 3alpha,7alpha,12alpha-trihydroxy-5beta-cholest-24-enoyl-CoA hydratase activity; estradiol 17-beta-dehydrogenase activity; isomerase activity; long-chain-enoyl-CoA hydratase activity; lyase activity; nucleotide binding; oxidoreductase activity; sterol binding; sterol transporter activity; |
◆ Recombinant Proteins | ||
HSD17B4-2583R | Recombinant Rat HSD17B4 Protein, His (Fc)-Avi-tagged | +Inquiry |
HSD17B4-7879M | Recombinant Mouse HSD17B4 Protein | +Inquiry |
HSD17B4-110H | Recombinant Human HSD17B4 protein, MYC/DDK-tagged | +Inquiry |
HSD17B4-1417H | Recombinant Human HSD17B4 Protein (1-736 aa), His-tagged | +Inquiry |
HSD17B4-13960H | Recombinant Human HSD17B4, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HSD17B4-5373HCL | Recombinant Human HSD17B4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HSD17B4 Products
Required fields are marked with *
My Review for All HSD17B4 Products
Required fields are marked with *
0
Inquiry Basket