Recombinant Human HSD17B1

• Cat.No.: HSD17B1-27735TH
• Product Overview: Recombinant fragment of Human HSD17B1 (aa 189-285) with N-terminal proprietary tag, 36.3 kDa.

Specification

• Description: Estradiol 17-beta-dehydrogenase 1 is an enzyme that in humans is encoded by the HSD17B1 gene.
• Protein length: 97 amino acids
• Molecular Weight: 36.300kDa inclusive of tags
• Source: Wheat germ
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: VHTAFMEKVLGSPEEVLDRTDIHTFHRFYQYLAHSKQVFREAAQNPEEVAEVFLTALRAPKPTLRYFTTERFLPLLRMRLDDPSGSNYVTAMHREVF
• Sequence Similarities: Belongs to the short-chain dehydrogenases/reductases (SDR) family.
• Tag: Non

Gene Information

• Gene Name: HSD17B1 hydroxysteroid (17-beta) dehydrogenase 1 [ Homo sapiens ]
• Official Symbol: HSD17B1
• Synonyms: HSD17B1; hydroxysteroid (17-beta) dehydrogenase 1; EDH17B2, EDHB17; estradiol 17-beta-dehydrogenase 1; Estradiol 17 beta dehydrogenase 1; HSD17; MGC138140; SDR28C1; short chain dehydrogenase/reductase family 28CE; member 1
• Gene ID: 3292
• mRNA Refseq: NM_000413
• Protein Refseq: NP_000404
• MIM: 109684
• Uniprot ID: P14061
• Chromosome Location: 17q11-q21
• Pathway: Estrogen biosynthesis, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism of lipids and lipoproteins, organism-specific biosystem; Metabolism of steroid hormones and vitamins A and D, organism-specific biosystem; Steroid Biosynthesis, organism-specific biosystem
• Function: catalytic activity; estradiol 17-beta-dehydrogenase activity; nucleotide binding; oxidoreductase activity