Recombinant Human HSD11B1 Protein, His-tagged
Cat.No. : | HSD11B1-13951H |
Product Overview : | Recombinant Human HSD11B1 Protein (1-292 aa) is produced by E. coli-derived expression system. This protein is fused with a His tag at the N-terminal. |
Availability | April 20, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-292 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58 mM Na2HPO4,17 mM NaH2PO4, 68 mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
Molecular Mass : | 32 kDa |
AA Sequence : | MAFMKKYLLPILGLFMAYYYYSANEEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPCRKILEFLYSTSYNMDRFINK |
Purity : | > 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20 centigrade to -80 centigrade as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8 centigrade for (1-2 weeks). Long-term storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details). If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used). Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. |
Shipping : | The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature. |
Gene Name | HSD11B1 hydroxysteroid (11-beta) dehydrogenase 1 [ Homo sapiens ] |
Official Symbol | HSD11B1 |
Synonyms | HSD11B1; SDR26C1; HDL; 11-DH; HSD11; HSD11B; HSD11L; 11-beta-HSD1; MGC13539; |
Gene ID | 3290 |
mRNA Refseq | NM_001206741 |
Protein Refseq | NP_001193670 |
MIM | 600713 |
◆ Recombinant Proteins | ||
HSD11B1-5060H | Recombinant Human HSD11B1 Protein, GST-tagged | +Inquiry |
Hsd11b1-476R | Recombinant Rat Hsd11b1 Protein, His-tagged | +Inquiry |
HSD11B1-0320H | Recombinant Human HSD11B1 Protein (M1-K292), His/Strep tagged | +Inquiry |
HSD11B1-7869M | Recombinant Mouse HSD11B1 Protein | +Inquiry |
HSD11B1-1099H | Recombinant Human HSD11B1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HSD11B1-5381HCL | Recombinant Human HSD11B1 293 Cell Lysate | +Inquiry |
HSD11B1-5380HCL | Recombinant Human HSD11B1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HSD11B1 Products
Required fields are marked with *
My Review for All HSD11B1 Products
Required fields are marked with *
0
Inquiry Basket