Recombinant Human HPRT1 protein, His-tagged

• Cat.No.: HPRT1-2895H
• Product Overview: Recombinant Human HPRT1 protein(P00492)(MHHHHHHGALFLAFLAAALSLMGLWSQPKKKRKVGIGEVLHELADDLPELQSWIKAAQQLGGGGSGFLGPAPAPAPAPA+2-218aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Source: E.coli
• Species: Human
• Tag: His
• Protein length: MHHHHHHGALFLAFLAAALSLMGLWSQPKKKRKVGIGEVLHELADDLPELQSWIKAAQQLGGGGSGFLGPAPAPAPAPA+2-218aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 32.7 kDa
• AASequence: ATRSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: HPRT1 hypoxanthine phosphoribosyltransferase 1 [ Homo sapiens ]
• Official Symbol: HPRT1
• Synonyms: HPRT1; hypoxanthine phosphoribosyltransferase 1; HPRT; hypoxanthine-guanine phosphoribosyltransferase; HGPRT; Lesch Nyhan syndrome; HGPRTase
• Gene ID: 3251
• mRNA Refseq: NM_000194
• Protein Refseq: NP_000185
• MIM: 308000
• UniProt ID: P00492