Recombinant Human HPRT1 Protein, GST-tagged

• Cat.No.: HPRT1-5011H
• Product Overview: Human HPRT1 full-length ORF ( AAH00578, 1 a.a. - 218 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene is a transferase, which catalyzes conversion of hypoxanthine to inosine monophosphate and guanine to guanosine monophosphate via transfer of the 5-phosphoribosyl group from 5-phosphoribosyl 1-pyrophosphate. This enzyme plays a central role in the generation of purine nucleotides through the purine salvage pathway. Mutations in this gene result in Lesch-Nyhan syndrome or gout
• Molecular Mass: 49.72 kDa
• AA Sequence: MATRSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HPRT1 hypoxanthine phosphoribosyltransferase 1 [ Homo sapiens ]
• Official Symbol: HPRT1
• Synonyms: HPRT1; hypoxanthine phosphoribosyltransferase 1; HPRT; hypoxanthine-guanine phosphoribosyltransferase; HGPRT; Lesch Nyhan syndrome; HGPRTase
• Gene ID: 3251
• mRNA Refseq: NM_000194
• Protein Refseq: NP_000185
• MIM: 308000
• UniProt ID: P00492