Recombinant Human HOXC8 Protein, GST-tagged

Cat.No. : HOXC8-4985H
Product Overview : Human HOXC8 full-length ORF ( NP_073149.1, 1 a.a. - 242 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXC genes located in a cluster on chromosome 12. The product of this gene may play a role in the regulation of cartilage differentiation. It could also be involved in chondrodysplasias or other cartilage disorders. [provided by RefSeq
Source : Wheat Germ
Species : Human
Tag : GST
Molecular Mass : 54.2 kDa
AA Sequence : MSSYFVNPLFSKYKAGESLEPAYYDCRFPQSVGRSHALVYGPGGSAPGFQHASHHVQDFFHHGTSGISNSGYQQNPCSLSCHGDASKFYGYEALPRQSLYGAQQEASVVQYPDCKSSANTNSSEGQGHLNQNSSPSLMFPWMRPHAPGRRSGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKENNKDKLPGARDEEKVEEEGNEEEEKEEEEKEENKD
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HOXC8 homeobox C8 [ Homo sapiens ]
Official Symbol HOXC8
Synonyms HOXC8; homeobox C8; homeo box C8 , HOX3, HOX3A; homeobox protein Hox-C8; homeo box 3A; homeo box C8; homeobox protein Hox-3A; Hox-3.1, mouse, homolog of; HOX3; HOX3A;
Gene ID 3224
mRNA Refseq NM_022658
Protein Refseq NP_073149
MIM 142970
UniProt ID P31273

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All HOXC8 Products

Required fields are marked with *

My Review for All HOXC8 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon