Recombinant Human HOXC8 Protein, GST-tagged

• Cat.No.: HOXC8-4985H
• Product Overview: Human HOXC8 full-length ORF ( NP_073149.1, 1 a.a. - 242 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXC genes located in a cluster on chromosome 12. The product of this gene may play a role in the regulation of cartilage differentiation. It could also be involved in chondrodysplasias or other cartilage disorders. [provided by RefSeq
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 54.2 kDa
• AA Sequence: MSSYFVNPLFSKYKAGESLEPAYYDCRFPQSVGRSHALVYGPGGSAPGFQHASHHVQDFFHHGTSGISNSGYQQNPCSLSCHGDASKFYGYEALPRQSLYGAQQEASVVQYPDCKSSANTNSSEGQGHLNQNSSPSLMFPWMRPHAPGRRSGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKENNKDKLPGARDEEKVEEEGNEEEEKEEEEKEENKD
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HOXC8 homeobox C8 [ Homo sapiens ]
• Official Symbol: HOXC8
• Synonyms: HOXC8; homeobox C8; homeo box C8 , HOX3, HOX3A; homeobox protein Hox-C8; homeo box 3A; homeo box C8; homeobox protein Hox-3A; Hox-3.1, mouse, homolog of; HOX3; HOX3A
• Gene ID: 3224
• mRNA Refseq: NM_022658
• Protein Refseq: NP_073149
• MIM: 142970
• UniProt ID: P31273