Recombinant Human HNF1B

Cat.No. : HNF1B-29461TH
Product Overview : Recombinant fragment of Human TCF2 with N terminal proprietary tag; Predicted MW 37.29kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 105 amino acids
Description : This gene encodes a member of the homeodomain-containing superfamily of transcription factors. The protein binds to DNA as either a homodimer, or a heterodimer with the related protein hepatocyte nuclear factor 1-alpha. The gene has been shown to function in nephron development, and regulates development of the embryonic pancreas. Mutations in this gene result in renal cysts and diabetes syndrome and noninsulin-dependent diabetes mellitus, and expression of this gene is altered in some types of cancer. Multiple transcript variants encoding different isoforms have been found for this gene.
Molecular Weight : 37.290kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : VRKQREILRQFNQTVQSSGNMTDKSSQDQLLFLFPEFSQQ SHGPGQSDDACSEPTNKKMRRNRFKWGPASQQILYQAYDR QKNPSKEEREALVEECNRAECLQRG
Sequence Similarities : Belongs to the HNF1 homeobox family.Contains 1 homeobox DNA-binding domain.
Gene Name HNF1B HNF1 homeobox B [ Homo sapiens ]
Official Symbol HNF1B
Synonyms HNF1B; HNF1 homeobox B; TCF2, transcription factor 2, hepatic; LF B3; variant hepatic nuclear factor; hepatocyte nuclear factor 1-beta; HNF1beta; LFB3; MODY5; VHNF1;
Gene ID 6928
mRNA Refseq NM_000458
Protein Refseq NP_000449
MIM 189907
Uniprot ID P35680
Chromosome Location 17q12
Pathway Developmental Biology, organism-specific biosystem; Maturity onset diabetes of the young, organism-specific biosystem; Maturity onset diabetes of the young, conserved biosystem; Regulation of beta-cell development, organism-specific biosystem; Regulation of gene expression in early pancreatic precursor cells, organism-specific biosystem;
Function DNA binding; protein binding; protein heterodimerization activity; protein homodimerization activity; protein homodimerization activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All HNF1B Products

Required fields are marked with *

My Review for All HNF1B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon