Recombinant Human HMGN2 Protein, GST-tagged

Cat.No. : HMGN2-4880H
Product Overview : Human HMGN2 full-length ORF ( AAH14644, 1 a.a. - 90 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene binds nucleosomal DNA and is associated with transcriptionally active chromatin. Along with a similar protein, HMGN1, the encoded protein may help maintain an open chromatin configuration around transcribable genes. The protein has also been found to have antimicrobial activity against bacteria, viruses and fungi. [provided by RefSeq, Oct 2014]
Molecular Mass : 35.64 kDa
AA Sequence : MPKRKAEEDAKGDKAKVKDEPQRRSARLSAKPAPPKPEPKPKKAPAKKGEKVPKGKKGKADAGKEGNNPAENGDAKTDQAQKAEGAGDAK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HMGN2 high mobility group nucleosomal binding domain 2 [ Homo sapiens ]
Official Symbol HMGN2
Synonyms HMG17
Gene ID 3151
mRNA Refseq NM_005517
Protein Refseq NP_005508
MIM 163910
UniProt ID P05204

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All HMGN2 Products

Required fields are marked with *

My Review for All HMGN2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon