Recombinant Human HLA-A protein, His-tagged
Cat.No. : | HLA-A-3958H |
Product Overview : | Recombinant Human HLA-A protein(P30443)(25-308aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 25-308aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 36.7 kDa |
AA Sequence : | GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQKMEPRAPWIEQEGPEYWDQETRNMKAHSQTDRANLGTLRGYYNQSEDGSHTIQIMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAVHAAEQRRVYLEGRCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWELSSQPTIPI |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | HLA-A major histocompatibility complex, class I, A [ Homo sapiens ] |
Official Symbol | HLA-A |
Synonyms | HLA-A; major histocompatibility complex, class I, A; HLA class I histocompatibility antigen, A-1 alpha chain; antigen presenting molecule; leukocyte antigen class I-A; MHC class I antigen HLA-A heavy chain; HLAA; FLJ26655; |
Gene ID | 3105 |
mRNA Refseq | NM_001242758 |
Protein Refseq | NP_001229687 |
UniProt ID | P01891 |
◆ Recombinant Proteins | ||
HLA-A-2936H | Recombinant Human HLA-A Protein (Gly25-Leu300), N-His tagged | +Inquiry |
HLA-A-733H | Recombinant Human HLA-A0201 MAGE-A4 (GVYDGREHTV) complex protein, His-Avi-tagged | +Inquiry |
HLA-A-2242H | Recombinant Human HLA-A Protein, His-tagged | +Inquiry |
HLA-A-732H | Recombinant Human HLA-A0201 gp100 (YLEPGPVTA) complex protein, His-Avi-tagged | +Inquiry |
HLA-A-938H | Recombinant Human HLA-A protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HLA-A-5503HCL | Recombinant Human HLA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HLA-A Products
Required fields are marked with *
My Review for All HLA-A Products
Required fields are marked with *
0
Inquiry Basket