Recombinant Human HIBADH protein, His&Myc-tagged
Cat.No. : | HIBADH-5454H |
Product Overview : | Recombinant Human HIBADH protein(P31937)(37-336aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 37-336aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 39.0 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | ASKTPVGFIGLGNMGNPMAKNLMKHGYPLIIYDVFPDACKEFQDAGEQVVSSPADVAEKADRIITMLPTSINAIEAYSGANGILKKVKKGSLLIDSSTIDPAVSKELAKEVEKMGAVFMDAPVSGGVGAARSGNLTFMVGGVEDEFAAAQELLGCMGSNVVYCGAVGTGQAAKICNNMLLAISMIGTAEAMNLGIRLGLDPKLLAKILNMSSGRCWSSDTYNPVPGVMDGVPSANNYQGGFGTTLMAKDLGLAQDSATSTKSPILLGSLAHQIYRMMCAKGYSKKDFSSVFQFLREEETF |
Gene Name | HIBADH 3-hydroxyisobutyrate dehydrogenase [ Homo sapiens ] |
Official Symbol | HIBADH |
Synonyms | HIBADH; 3-hydroxyisobutyrate dehydrogenase; 3-hydroxyisobutyrate dehydrogenase, mitochondrial; NS5ATP1; MGC40361; |
Gene ID | 11112 |
mRNA Refseq | NM_152740 |
Protein Refseq | NP_689953 |
MIM | 608475 |
UniProt ID | P31937 |
◆ Recombinant Proteins | ||
HIBADH-2839R | Recombinant Rat HIBADH Protein | +Inquiry |
HIBADH-246H | Recombinant Human HIBADH Protein, MYC/DDK-tagged | +Inquiry |
HIBADH-4742H | Recombinant Human HIBADH Protein, GST-tagged | +Inquiry |
Hibadh-3391M | Recombinant Mouse Hibadh Protein, Myc/DDK-tagged | +Inquiry |
HIBADH-4158M | Recombinant Mouse HIBADH Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HIBADH-785HCL | Recombinant Human HIBADH cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HIBADH Products
Required fields are marked with *
My Review for All HIBADH Products
Required fields are marked with *
0
Inquiry Basket