Recombinant Human HEXIM2 Protein, GST-tagged

• Cat.No.: HEXIM2-4714H
• Product Overview: Human HEXIM2 full-length ORF ( NP_653209.1, 1 a.a. - 286 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the HEXIM family of proteins. This protein is a component of the 7SK small nuclear ribonucleoprotein. This protein has been found to negatively regulate the kinase activity of the cyclin-dependent kinase P-TEFb, which phosphorylates multiple target proteins to promote transcriptional elongation. This gene is located approximately 7 kb downstream from related family member HEXIM1 on chromosome 17. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2015]
• Molecular Mass: 58.8 kDa
• AA Sequence: MMATPNQTACNAESPVALEEAKTSGAPGSPQTPPERHDSGGSLPLTPRMESHSEDEDLAGAVGGLGWNSRSPRTQSPGGCSAEAVLARKKHRRRPSKRKRHWRPYLELSWAEKQQRDERQSQRASRVREEMFAKGQPVAPYNTTQFLMNDRDPEEPNLDVPHGISHPGSSGESEAGDSDGRGRAHGEFQRKDFSETYERFHTESLQGRSKQELVRDYLELEKRLSQAEEETRRLQQLQACTGQQSCRQVEELAAEVQRLRTENQRLRQENQMWNREGCRCDEEPGT
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HEXIM2 hexamethylene bis-acetamide inducible 2 [ Homo sapiens ]
• Official Symbol: HEXIM2
• Synonyms: HEXIM2; hexamethylene bis-acetamide inducible 2; protein HEXIM2; FLJ32384; MAQ1 paralog; hexamthylene bis-acetamide inducible 2; hexamethylene bis-acetamide-inducible protein 2; hexamethylene-bis-acetamide-inducible transcript 2; L3
• Gene ID: 124790
• mRNA Refseq: NM_144608
• Protein Refseq: NP_653209
• UniProt ID: Q96MH2