Recombinant Human HES5 Protein, MYC/DDK-tagged, C13 and N15-labeled
Cat.No. : | HES5-436H |
Product Overview : | HES5 MS Standard C13 and N15-labeled recombinant protein (NP_001010926) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a member of a family of basic helix-loop-helix transcriptional repressors. The protein product of this gene, which is activated downstream of the Notch pathway, regulates cell differentiation in multiple tissues. Disruptions in the normal expression of this gene have been associated with developmental diseases and cancer. [provided by RefSeq, Dec 2008] |
Molecular Mass : | 18 kDa |
AA Sequence : | MAPSTVAVELLSPKEKNRLRKPVVEKMRRDRINSSIEQLKLLLEQEFARHQPNSKLEKADILEMAVSYLKHSKAFVAAAGPKSLHQDYSEGYSWCLQEAVQFLTLHAASDTQMKLLYHFQRPPAAPAAPAKEPKAPGAAPPPALSAKATAAAAAAHQPACGLWRPWTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | HES5 hes family bHLH transcription factor 5 [ Homo sapiens (human) ] |
Official Symbol | HES5 |
Synonyms | HES5; hes family bHLH transcription factor 5; bHLHb38; transcription factor HES-5; class B basic helix-loop-helix protein 38; hairy and enhancer of split 5 |
Gene ID | 388585 |
mRNA Refseq | NM_001010926 |
Protein Refseq | NP_001010926 |
MIM | 607348 |
UniProt ID | Q5TA89 |
◆ Recombinant Proteins | ||
HES5-4134M | Recombinant Mouse HES5 Protein, His (Fc)-Avi-tagged | +Inquiry |
HES5-1988C | Recombinant Chicken HES5 | +Inquiry |
HES5-379H | Recombinant Human HES5 Protein, His-tagged | +Inquiry |
HES5-2487R | Recombinant Rat HES5 Protein, His (Fc)-Avi-tagged | +Inquiry |
HES5-2832R | Recombinant Rat HES5 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
HES5-5581HCL | Recombinant Human HES5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HES5 Products
Required fields are marked with *
My Review for All HES5 Products
Required fields are marked with *
0
Inquiry Basket