Recombinant Human HEPACAM, His-tagged

• Cat.No.: HEPACAM-101H
• Product Overview: Recombinant Human Hepatocyte Cell Adhesion Molecule/HEPACAM produced by transfected human cellss is a secreted protein with sequence (Val34-Ser240) of Human HEPACAM fused with a polyhistidine tag at the C-terminus.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: 34-240 a.a.
• Description: Hepatocyte Cell Adhesion Molecule (HEPACAM) is a single-pass type I membrane protein that localizes to the cytoplasmic side of the cell membrane. HEPACAM includes a signal sequence (amino acid 1-33), an extracellular region (amino acid 34-240) with one Ig-like C2-type domain and one Ig-like V-type domain, a transmembrane segment (amino acid 241-261), and a cytoplasmic domain (amino acid 262 - 416). The cytoplasmic domain plays an important role in regulation of cell-matrix adhesion and cell motility. HEPACAM acts as a homodimer and dimer formation occurs predominantly through cis interactions on the cell surface. HEPACAM is involved in cell motility and cell-matrix interactions. The expression of this gene is down-regulated or undetectable in many cancer cell lines, so this may be a tumor suppressor gene.
• Form: Lyophilized from a 0.2 μM filtered solution of 20mM PB, 150mM NaCl, pH 7.2
• AA Sequence: VNITSPVRLIHGTVGKSALLSVQYSSTSSDRPVVKWQLKRDKPVTVVQSIGTEVIGTLRPDYRDR IRLFENGSLLLSDLQLADEGTYEVEISITDDTFTGEKTINLTVDVPISRPQVLVASTTVLELSEA FTLNCSHENGTKPSYTWLKDGKPLLNDSRMLLSPDQKVLTITRVLMEDDDLYSCMVENPISQGRS LPVKITVYRRSSVDHHHHHH
• Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
• Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
• Storage: Lyophilized protein should be stored at Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at
• Reconstitution: Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Gene Information

• Gene Name: HEPACAM hepatic and glial cell adhesion molecule [ Homo sapiens ]
• Official Symbol: HEPACAM
• Synonyms: HEPACAM; hepatic and glial cell adhesion molecule; hepatocyte cell adhesion molecule; FLJ25530; glial cell adhesion molecule; GLIALCAM; hepaCAM; protein hepaCAM; MLC2A; MLC2B; GlialCAM
• Gene ID: 220296
• mRNA Refseq: NM_152722
• Protein Refseq: NP_689935
• MIM: 611642
• UniProt ID: Q14CZ8
• Chromosome Location: 11q24.2