Recombinant Human HEMGN Protein, GST-tagged

• Cat.No.: HEMGN-4686H
• Product Overview: Human HEMGN full-length ORF ( NP_060907.2, 1 a.a. - 484 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: HEMGN (Hemogen) is a Protein Coding gene. Diseases associated with HEMGN include Isolated Cleft Lip.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 81.7 kDa
• AA Sequence: MDLGKDQSHLKHHQTPDPHQEENHSPEVIGTWSLRNRELLRKRKAEVHEKETSQWLFGEQKKRKQQRTGKGNRRGRKRQQNTELKVEPQPQIEKEIVEKALAPIEKKTEPPGSITKVFPSVASPQKVVPEEHFSEICQESNIYQENFSEYQEIAVQNHSSETCQHVSEPEDLSPKMYQEISVLQDNSSKICQDMKEPEDNSPNTCQVISVIQDHPFKMYQDMAKREDLAPKMCQEAAVPKILPCPTSEDTADLAGCSLQAYPKPDVPKGYILDTDQNPAEPEEYNETDQGIAETEGLFPKIQEIAEPKDLSTKTHQESAEPKYLPHKTCNEIIVPKAPSHKTIQETPHSEDYSIEINQETPGSEKYSPETYQEIPGLEEYSPEIYQETSQLEEYSPEIYQETPGPEDLSTETYKNKDVPKECFPEPHQETGGPQGQDPKAHQEDAKDAYTFPQEMKEKPKEEPGIPAILNESHPENDVYSYVLF
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HEMGN hemogen [ Homo sapiens ]
• Official Symbol: HEMGN
• Synonyms: HEMGN; hemogen; EDAG; hemopoietic gene protein; negative differentiation regulator protein; erythroid differentiation-associated gene protein; EDAG-1
• Gene ID: 55363
• mRNA Refseq: NM_018437
• Protein Refseq: NP_060907
• MIM: 610715
• UniProt ID: Q9BXL5