Recombinant Human HELT Protein, GST-tagged

• Cat.No.: HELT-4684H
• Product Overview: Human HELT full-length ORF ( AAI60136.1, 1 a.a. - 327 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: HELT (Helt BHLH Transcription Factor) is a Protein Coding gene. GO annotations related to this gene include transcription factor activity, sequence-specific DNA binding and protein dimerization activity. An important paralog of this gene is HEY1.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36 kDa
• AA Sequence: MSDKLKERKVSRLSPNGTCALVVEASDSPTRHLGGPMAGKCPHGTLSVEESRVRTPVSHKVIEKRRRDRINRCLNELGKTVPMALAKQGEPQEALAQIRSRVRSLVLSSATVPDQQALGRCEGPFLLLQSSGKLEKAEILEMTVQYLRALHSADFPRGREKAELLAEFANYFHYGYHECMKNLVHYLTTVERMETKDTKYARILAFLQSKARLGAEPAFPPLGSLPEPDFSYQLHPAGPEFAGHSPGEAAVFPQGSGAGPFPWPPGAARSPALPYLPSAPVPLASPAQQHSPFLTPVQGLDRHYLNLIGHAHPNALNLHTPQHPPVL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HELT helt bHLH transcription factor [ Homo sapiens ]
• Official Symbol: HELT
• Synonyms: HELT; helt bHLH transcription factor; HES/HEY like transcription factor , Hey like transcription factor (zebrafish); hairy and enhancer of split-related protein HELT; bHLHb44; HCM1228; HES like; HESL; MEGANE; megane bHLH factor; Mgn; Heslike; Megane bHLH factor; Hey-like transcription factor; HES/HEY-like transcription factor; Hey-like transcriptional repressor
• Gene ID: 391723
• mRNA Refseq: NM_001029887
• Protein Refseq: NP_001025058
• UniProt ID: A6NFD8