Recombinant Human HEATR6 protein, His&Myc-tagged
Cat.No. : | HEATR6-4522H |
Product Overview : | Recombinant Human HEATR6 protein(Q6AI08)(1052-1175aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 1052-1175aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 18.5 kDa |
AA Sequence : | KSEDTIDFLEFKYCVSLRTQICQALIHLLSLASASDLPCMKETLELSGNMVQSYILQFLKSGAEGDDTGAPHSPQERDQMVRMALKHMGSIQAPTGDTARRAIMGFLEEILAVCFDSSGSQGAL |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | HEATR6 HEAT repeat containing 6 [ Homo sapiens ] |
Official Symbol | HEATR6 |
Synonyms | ABC1 |
Gene ID | 63897 |
mRNA Refseq | NM_022070.4 |
Protein Refseq | NP_071353.4 |
UniProt ID | Q6AI08 |
◆ Recombinant Proteins | ||
HEATR6-1059H | Recombinant Human HEATR6 Protein, His (Fc)-Avi-tagged | +Inquiry |
HEATR6-2477R | Recombinant Rat HEATR6 Protein, His (Fc)-Avi-tagged | +Inquiry |
HEATR6-4107M | Recombinant Mouse HEATR6 Protein, His (Fc)-Avi-tagged | +Inquiry |
HEATR6-2822R | Recombinant Rat HEATR6 Protein | +Inquiry |
HEATR6-2059H | Recombinant Human HEATR6 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HEATR6 Products
Required fields are marked with *
My Review for All HEATR6 Products
Required fields are marked with *
0
Inquiry Basket