Recombinant Human HEATR6 protein, His&Myc-tagged

• Cat.No.: HEATR6-4522H
• Product Overview: Recombinant Human HEATR6 protein(Q6AI08)(1052-1175aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli

Specification

• Source: E. coli
• Species: Human
• Tag: His&Myc
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 18.5 kDa
• Protein length: 1052-1175aa
• AA Sequence: KSEDTIDFLEFKYCVSLRTQICQALIHLLSLASASDLPCMKETLELSGNMVQSYILQFLKSGAEGDDTGAPHSPQERDQMVRMALKHMGSIQAPTGDTARRAIMGFLEEILAVCFDSSGSQGAL
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: HEATR6 HEAT repeat containing 6 [ Homo sapiens ]
• Official Symbol: HEATR6
• Synonyms: ABC1
• Gene ID: 63897
• mRNA Refseq: NM_022070.4
• Protein Refseq: NP_071353.4
• UniProt ID: Q6AI08