Recombinant Human HDHD3 protein, His-tagged

• Cat.No.: HDHD3-13718H
• Product Overview: Recombinant Human HDHD3 protein(1-251 aa), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-251 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• AA Sequence: MAHRLQIRLLTWDVKDTLLRLRHPLGEAYATKARAHGLEVEPSALEQGFRQAYRAQSHSFPNYGLSHGLTSRQWWLDVVLQTFHLAGVQDAQAVAPIAEQLYKDFSHPCTWQVLDGAEDTLRECRTRGLRLAVISNFDRRLEGILGGLGLREHFDFVLTSEAAGWPKPDPRIFQEALRLAHMEPVVAAHVGDNYLCDYQGPRAVGMHSFLVVGPQALDPVVRDSVPKEHILPSLAHLLPALDCLEGSTPGL
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.

Gene Information

• Official Symbol: HDHD3
• Synonyms: HDHD3; haloacid dehalogenase-like hydrolase domain containing 3; C9orf158, chromosome 9 open reading frame 158; haloacid dehalogenase-like hydrolase domain-containing protein 3; MGC12904; C9orf158; 2810435D12Rik
• Gene ID: 81932
• mRNA Refseq: NM_031219
• Protein Refseq: NP_112496
• UniProt ID: Q9BSH5