Recombinant Human HDDC2 Protein, GST-tagged

• Cat.No.: HDDC2-4656H
• Product Overview: Human HDDC2 full-length ORF ( AAH66332.1, 1 a.a. - 204 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: HDDC2 (HD Domain Containing 2) is a Protein Coding gene.
• Molecular Mass: 49.8 kDa
• AA Sequence: MASVSSATFSGHGARSLLQFLRLVGQLKRVPRTGWVYRNVQRPESVSDHMYRMAVMAMVIKDDRLNKDRCVRLALVHDMAECIVGDIAPADNIPKEEKHRREEEAMKQITQLLPEDLRKELYELWEEYETRSSAEAKFVKQLDQCEMILQASEYEDLEHKPGRLQDFYDSTAGKFNHPEIVQLVSELEAERSTNIAAAASEPHS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HDDC2 HD domain containing 2 [ Homo sapiens ]
• Official Symbol: HDDC2
• Synonyms: C6orf74; CGI-130; NS5ATP2; dJ167O5.2
• Gene ID: 51020
• mRNA Refseq: NM_016063
• Protein Refseq: NP_057147
• UniProt ID: Q7Z4H3