Recombinant Human HDAC7 protein(447-530 aa), His-tagged

• Cat.No.: HDAC7-13710H
• Product Overview: Recombinant Human HDAC7 protein(447-530 aa) was expressed in E. coli, with a polyhistidine tag at the N-terminus.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Protein length: 447-530 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AASequence: EEGWKQKPNLNAIRSLEAVIRVHSKYWGCMQRLASCPDSWVPRVPGADKEEVEAVTALASLSVGILAEDRPSEQLVEEEEPMNL
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.

Gene Information

• Gene Name: HDAC7 histone deacetylase 7 [ Homo sapiens ]
• Official Symbol: HDAC7
• Synonyms: HDAC7; histone deacetylase 7; HDAC7A, histone deacetylase 7A; DKFZP586J0917; HD7; histone deacetylase 7A; HD7A; HDAC7A; FLJ99588; DKFZp586J0917
• Gene ID: 51564
• mRNA Refseq: NM_001098416
• Protein Refseq: NP_001091886
• MIM: 606542
• UniProt ID: Q8WUI4