Recombinant Human HDAC2 protein, His/GST-tagged

• Cat.No.: HDAC2-13707H
• Product Overview: Recombinant Human HDAC2 protein(NP_001518.3)(Met1~Pro488), fused to His and GST Tag at the N-terminus, was expressed in E.coli.

Specification

• Description: This gene product belongs to the histone deacetylase family. Histone deacetylases act via the formation of large multiprotein complexes, and are responsible for the deacetylation of lysine residues at the N-terminal regions of core histones (H2A, H2B, H3 and H4). This protein forms transcriptional repressor complexes by associating with many different proteins, including YY1, a mammalian zinc-finger transcription factor. Thus, it plays an important role in transcriptional regulation, cell cycle progression and developmental events. Alternative splicing results in multiple transcript variants.
• Source: E. coli
• Species: Human
• Tag: His&GST
• Form: 20mM Tris, 150mM NaCl, pH8.0, containing 1mM EDTA, 1mM DTT, 0.01% SKL, 5% Trehalose and Proclin300.
• Molecular Mass: 85kDa as determined by SDS-PAGE reducing conditions.
• Protein length: Met1~Pro488
• AA Sequence: MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGTKSEQLSNP
• Endotoxin: <1.0EU per 1µg (determined by the LAL method)
• Purity: > 90%
• Applications: Positive Control; Immunogen; SDS-PAGE; WB. (May be suitable for use in other assays to be determined by the end user.)
• Notes: The kit is designed for research use only, we will not be responsible for any issue if the kit was used in clinical diagnostic or any other procedures.
• Stability: The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37°C for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition.
• Storage: Avoid repeated freeze/thaw cycles.
  Store at 2-8°C for one month.
  Aliquot and store at -80°C for 12 months.
• Reconstitution: Reconstitute in 20mM Tris, 150mM NaCl (pH8.0) to a concentration of 0.1-1.0 mg/mL. Do not vortex.

Gene Information

• Gene Name: HDAC2 histone deacetylase 2 [ Homo sapiens (human) ]
• Official Symbol: HDAC2
• Synonyms: HD2; RPD3; YAF1; KDAC2
• Gene ID: 3066
• mRNA Refseq: NM_001527.4
• Protein Refseq: NP_001518.3
• MIM: 605164
• UniProt ID: Q92769