Recombinant Human H2BU1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: H2BU1-4322H
• Product Overview: HIST3H2BB MS Standard C13 and N15-labeled recombinant protein (NP_778225) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: Myc&DDK
• Description: Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H2B family. Transcripts from this gene contain a palindromic termination element.
• Molecular Mass: 13.9 kDa
• AA Sequence: MPDPSKSAPAPKKGSKKAVTKAQKKDGKKRKRGRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIASEASRLAHYNKRSTITSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTSSKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: H2BU1 H2B.U histone 1 [ Homo sapiens (human) ]
• Official Symbol: H2BU1
• Synonyms: H2BU1; H2B.U histone 1; H2Bb; HIST3H2BB; histone H2B type 3-B; H2B type 12; histone 3, H2bb; histone cluster 3 H2B family member b; histone cluster 3, H2bb
• Gene ID: 128312
• mRNA Refseq: NM_175055
• Protein Refseq: NP_778225
• MIM: 615046
• UniProt ID: Q8N257