Recombinant Human GUCY2C Protein, GST-tagged

• Cat.No.: GUCY2C-4492H
• Product Overview: Human GUCY2C partial ORF ( NP_004954, 24 a.a. - 133 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a transmembrane protein that functions as a receptor for endogenous peptides guanylin and uroguanylin, and the heat-stable E. coli enterotoxin. The encoded protein activates the cystic fibrosis transmembrane conductance regulator. Mutations in this gene are associated with familial diarrhea (autosomal dominant) and meconium ileus (autosomal recessive). [provided by RefSeq, Nov 2016]
• Molecular Mass: 37.73 kDa
• AA Sequence: SQVSQNCHNGSYEISVLMMGNSAFAEPLKNLEDAVNEGLEIVRGRLQNAGLNVTVNATFMYSDGLIHNSGDCRSSTCEGLDLLRKISNAQRMGCVLIGPSCTYSTFQMYL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GUCY2C guanylate cyclase 2C (heat stable enterotoxin receptor) [ Homo sapiens ]
• Official Symbol: GUCY2C
• Synonyms: GUCY2C; guanylate cyclase 2C (heat stable enterotoxin receptor); GUC2C; heat-stable enterotoxin receptor; STAR; GC-C; hSTAR; STA receptor; guanylyl cyclase C; intestinal guanylate cyclase
• Gene ID: 2984
• mRNA Refseq: NM_004963
• Protein Refseq: NP_004954
• MIM: 601330
• UniProt ID: P25092