Recombinant Human GUCY2C Protein, GST-tagged
Cat.No. : | GUCY2C-4492H |
Product Overview : | Human GUCY2C partial ORF ( NP_004954, 24 a.a. - 133 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a transmembrane protein that functions as a receptor for endogenous peptides guanylin and uroguanylin, and the heat-stable E. coli enterotoxin. The encoded protein activates the cystic fibrosis transmembrane conductance regulator. Mutations in this gene are associated with familial diarrhea (autosomal dominant) and meconium ileus (autosomal recessive). [provided by RefSeq, Nov 2016] |
Molecular Mass : | 37.73 kDa |
AA Sequence : | SQVSQNCHNGSYEISVLMMGNSAFAEPLKNLEDAVNEGLEIVRGRLQNAGLNVTVNATFMYSDGLIHNSGDCRSSTCEGLDLLRKISNAQRMGCVLIGPSCTYSTFQMYL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GUCY2C guanylate cyclase 2C (heat stable enterotoxin receptor) [ Homo sapiens ] |
Official Symbol | GUCY2C |
Synonyms | GUCY2C; guanylate cyclase 2C (heat stable enterotoxin receptor); GUC2C; heat-stable enterotoxin receptor; STAR; GC-C; hSTAR; STA receptor; guanylyl cyclase C; intestinal guanylate cyclase; |
Gene ID | 2984 |
mRNA Refseq | NM_004963 |
Protein Refseq | NP_004954 |
MIM | 601330 |
UniProt ID | P25092 |
◆ Recombinant Proteins | ||
GUCY2C-2640R | Recombinant Rat GUCY2C Protein (23-429 aa), His-Myc-tagged | +Inquiry |
GUCY2C-2756R | Recombinant Rat GUCY2C protein(Met1-Gln429), His-tagged | +Inquiry |
Gucy2c-5022R | Recombinant Rat Gucy2c protein, His&Myc-tagged | +Inquiry |
GUCY2C-669H | Recombinant Human GUCY2C protein, Fc-tagged | +Inquiry |
GUCY2C-3280C | Recombinant Cynomolgus monkey GUCY2C protein(24-430aa), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GUCY2C-5675HCL | Recombinant Human GUCY2C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GUCY2C Products
Required fields are marked with *
My Review for All GUCY2C Products
Required fields are marked with *
0
Inquiry Basket