Recombinant Human GUCA2B protein, His-SUMO-tagged

• Cat.No.: GUCA2B-4375H
• Product Overview: Recombinant Human GUCA2B protein(Q16661)(27-112aa), fused to N-terminal His-SUMO tag, was expressed in E. coli

Specification

• Source: E. coli
• Species: Human
• Tag: His&SUMO
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 25.5 kDa
• Protein length: 27-112aa
• AA Sequence: VYIQYQGFRVQLESMKKLSDLEAQWAPSPRLQAQSLLPAVCHHPALPQDLQPVCASQEASSIFKTLRTIANDDCELCVNVACTGCL
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: GUCA2B guanylate cyclase activator 2B (uroguanylin) [ Homo sapiens ]
• Official Symbol: GUCA2B
• Synonyms: GUCA2B; guanylate cyclase activator 2B (uroguanylin); guanylate cyclase activator 2B; uroguanylin; UGN; GCAP-II
• Gene ID: 2981
• mRNA Refseq: NM_007102
• Protein Refseq: NP_009033
• MIM: 601271
• UniProt ID: Q16661