Recombinant Human GTF3C2 protein, His-tagged

• Cat.No.: GTF3C2-2767H
• Product Overview: Recombinant Human GTF3C2 protein(59 - 188 aa), fused to His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• Protein length: 59 - 188 aa
• AA Sequence: GFEDSPDQRRLPPEQESLSRLEQPDLSSEMSKVSKPRASKPGRKRGGRTRKGPKRPQQPNPPSAPLVPGLLDQSNPLSTPMPKKRGRKSKAELLLLKLSKDLDRPESQSPKRPPEDFETPSGERPRRRAA
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: GTF3C2 general transcription factor IIIC, polypeptide 2, beta 110kDa [ Homo sapiens ]
• Official Symbol: GTF3C2
• Synonyms: GTF3C2; general transcription factor IIIC, polypeptide 2, beta 110kDa; general transcription factor IIIC, polypeptide 2 (beta subunit, 110kD); general transcription factor 3C polypeptide 2; KIAA0011; TFIIIC110; TF3C-beta; TFIIIC 110 kDa subunit; transcription factor IIIC subunit beta; transcription factor IIIC 110 kDa subunit; TFIIIC-BETA
• Gene ID: 2976
• mRNA Refseq: NM_001035521
• Protein Refseq: NP_001030598
• MIM: 604883
• UniProt ID: Q8WUA4