Recombinant Human GTF2H5 Protein, GST-tagged

• Cat.No.: GTF2H5-4453H
• Product Overview: Human GTF2H5 full-length ORF ( NP_997001.1, 1 a.a. - 71 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a subunit of transcription/repair factor TFIIH, which functions in gene transcription and DNA repair. This protein stimulates ERCC3/XPB ATPase activity to trigger DNA opening during DNA repair, and is implicated in regulating cellular levels of TFIIH. Mutations in this gene result in trichothiodystrophy, complementation group A. [provided by RefSeq, Mar 2009]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 34.5 kDa
• AA Sequence: MVNVLKGVLIECDPAMKQFLLYLDESNALGKKFIIQDIDDTHVFVIAELVNVLQERVGELMDQNAFSLTQK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GTF2H5 general transcription factor IIH subunit 5 [ Homo sapiens (human) ]
• Official Symbol: GTF2H5
• Synonyms: GTF2H5; general transcription factor IIH subunit 5; TTD; TFB5; TTD3; TTDA; TFIIH; TTD-A; TGF2H5; C6orf175; bA120J8.2; general transcription factor IIH subunit 5; TFB5 ortholog; TFIIH basal transcription factor complex TTD-A subunit; TFIIH basal transcription factor complex TTDA subunit; general transcription factor IIH, polypeptide 5; General Transcription Factor IIH Subunit 5; TFIIH Basal Transcription Factor Complex TTD-A Subunit; General Transcription Factor IIH, Polypeptide 5; TFB5 Ortholog; TFIIH Basal Transcription Factor Complex TTDA Subunit; DNA Repair Syndrome Trichothiodystrophy Group A; General Transcription Factor IIH Polypeptide 5; Chromosome 6 Open Reading Frame 175
• Gene ID: 404672
• mRNA Refseq: NM_207118
• Protein Refseq: NP_997001
• MIM: 608780
• UniProt ID: Q6ZYL4