Recombinant Human GTF2F1 protein(111-280 aa), C-His-tagged

Cat.No. : GTF2F1-2735H
Product Overview : Recombinant Human GTF2F1 protein(P35269)(111-280 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 111-280 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : KGIKKGGVTENTSYYIFTQCPDGAFEAFPVHNWYNFTPLARHRTLTAEEAEEEWERRNKVLNHFSIMQQRRLKDQDQDEDEEEKEKRGRRKASELRIHDLEDDLEMSSDASDASGEEGGRVPKAKKKAPLAKGGRKKKKKKGSDDEAFEDSDDGDFEGQEVDYMSDGSSS
Gene Name GTF2F1 general transcription factor IIF, polypeptide 1, 74kDa [ Homo sapiens ]
Official Symbol GTF2F1
Synonyms GTF2F1; general transcription factor IIF, polypeptide 1, 74kDa; general transcription factor IIF, polypeptide 1 (74kD subunit); general transcription factor IIF subunit 1; BTF4; RAP74; TF2F1; TFIIF; TFIIF-alpha; transcription initiation factor RAP74; general transcription factor IIF 74 kDa subunit; transcription initiation factor IIF subunit alpha;
Gene ID 2962
mRNA Refseq NM_002096
Protein Refseq NP_002087
MIM 189968
UniProt ID P35269

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All GTF2F1 Products

Required fields are marked with *

My Review for All GTF2F1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon