Recombinant Human GTF2F1 protein(111-280 aa), C-His-tagged

• Cat.No.: GTF2F1-2735H
• Product Overview: Recombinant Human GTF2F1 protein(P35269)(111-280 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Protein length: 111-280 aa
• Form: 0.15 M Phosphate buffered saline
• AASequence: KGIKKGGVTENTSYYIFTQCPDGAFEAFPVHNWYNFTPLARHRTLTAEEAEEEWERRNKVLNHFSIMQQRRLKDQDQDEDEEEKEKRGRRKASELRIHDLEDDLEMSSDASDASGEEGGRVPKAKKKAPLAKGGRKKKKKKGSDDEAFEDSDDGDFEGQEVDYMSDGSSS
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: GTF2F1 general transcription factor IIF, polypeptide 1, 74kDa [ Homo sapiens ]
• Official Symbol: GTF2F1
• Synonyms: GTF2F1; general transcription factor IIF, polypeptide 1, 74kDa; general transcription factor IIF, polypeptide 1 (74kD subunit); general transcription factor IIF subunit 1; BTF4; RAP74; TF2F1; TFIIF; TFIIF-alpha; transcription initiation factor RAP74; general transcription factor IIF 74 kDa subunit; transcription initiation factor IIF subunit alpha
• Gene ID: 2962
• mRNA Refseq: NM_002096
• Protein Refseq: NP_002087
• MIM: 189968
• UniProt ID: P35269