Recombinant Human GTF2F1 protein(111-280 aa), C-His-tagged
Cat.No. : | GTF2F1-2735H |
Product Overview : | Recombinant Human GTF2F1 protein(P35269)(111-280 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Source : | E. coli |
Species : | Human |
Tag : | His |
Protein length : | 111-280 aa |
Form : | 0.15 M Phosphate buffered saline |
AASequence : | KGIKKGGVTENTSYYIFTQCPDGAFEAFPVHNWYNFTPLARHRTLTAEEAEEEWERRNKVLNHFSIMQQRRLKDQDQDEDEEEKEKRGRRKASELRIHDLEDDLEMSSDASDASGEEGGRVPKAKKKAPLAKGGRKKKKKKGSDDEAFEDSDDGDFEGQEVDYMSDGSSS |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | GTF2F1 general transcription factor IIF, polypeptide 1, 74kDa [ Homo sapiens ] |
Official Symbol | GTF2F1 |
Synonyms | GTF2F1; general transcription factor IIF, polypeptide 1, 74kDa; general transcription factor IIF, polypeptide 1 (74kD subunit); general transcription factor IIF subunit 1; BTF4; RAP74; TF2F1; TFIIF; TFIIF-alpha; transcription initiation factor RAP74; general transcription factor IIF 74 kDa subunit; transcription initiation factor IIF subunit alpha; |
Gene ID | 2962 |
mRNA Refseq | NM_002096 |
Protein Refseq | NP_002087 |
MIM | 189968 |
UniProt ID | P35269 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All GTF2F1 Products
Required fields are marked with *
My Review for All GTF2F1 Products
Required fields are marked with *
0
Inquiry Basket