Recombinant Human GSTM5, GST-tagged

Cat.No. : GSTM5-27772TH
Product Overview : Recombinant full length Human GSTM5 with a N terminal proprietary tag: predicted molecular weight 50.05 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-transferase that belongs to the mu class. The mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding the mu class of enzymes are organized in a gene cluster on chromosome 1p13.3 and are known to be highly polymorphic. These genetic variations can change an individuals susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of certain drugs. Diversification of these genes has occurred in regions encoding substrate-binding domains, as well as in tissue expression patterns, to accommodate an increasing number of foreign compounds.
Protein length : 218 amino acids
Conjugation : GST
Molecular Weight : 50.050kDa inclusive of tags
Source : Wheat germ
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MPMTLGYWDIRGLAHAIRLLLEYTDSSYVEKKYTLGDAPD YDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILRYI ARKHNLCGETEEEKIRVDILENQVMDNHMELVRLCYDPDF EKLKPKYLEELPEKLKLYSEFLGKRPWFAGDKITFVDFLA YDVLDMKRIFEPKCLDAFLNLKDFISRFEGLKKISAYMKS SQFLRGLLFGKSATWNSK
Sequence Similarities : Belongs to the GST superfamily. Mu family.Contains 1 GST C-terminal domain.Contains 1 GST N-terminal domain.
Gene Name GSTM5 glutathione S-transferase mu 5 [ Homo sapiens ]
Official Symbol GSTM5
Synonyms GSTM5; glutathione S-transferase mu 5; glutathione S transferase M5; glutathione S-transferase Mu 5;
Gene ID 2949
mRNA Refseq NM_000851
Protein Refseq NP_000842
MIM 138385
Uniprot ID P46439
Chromosome Location 1p13.3
Pathway Biological oxidations, organism-specific biosystem; Drug metabolism - cytochrome P450, organism-specific biosystem; Drug metabolism - cytochrome P450, conserved biosystem; Glutathione conjugation, organism-specific biosystem; Glutathione metabolism, organism-specific biosystem;
Function glutathione transferase activity; transferase activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All GSTM5 Products

Required fields are marked with *

My Review for All GSTM5 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon