Recombinant Human GSTK1 Protein, GST-tagged

• Cat.No.: GSTK1-4414H
• Product Overview: Human GSTK1 full-length ORF ( AAH01231.1, 1 a.a. - 226 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the kappa class of the glutathione transferase superfamily of enzymes that function in cellular detoxification. The encoded protein is localized to the peroxisome and catalyzes the conjugation of glutathione to a wide range of hydrophobic substates facilitating the removal of these compounds from cells. Alternative splicing results in multiple transcript variants
• Molecular Mass: 50.60 kDa
• AA Sequence: MGPLPRTVELFYDVLSPYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDLKLLRHHLQIPIHFPKDFLSVMLEKGSLSAMRFLTAVNLEHPEMLEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLLEKIATPKVKNQLKETTEAACRYGAFGLPITVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPIPPAVNARL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GSTK1 glutathione S-transferase kappa 1 [ Homo sapiens ]
• Official Symbol: GSTK1
• Synonyms: GSTK1; glutathione S-transferase kappa 1; GST13; GST class-kappa; glutathione S-transferase k1; glutathione S-transferase subunit 13 homolog; GST; hGSTK1; GSTK1-1; GST13-13; GST 13-13
• Gene ID: 373156
• mRNA Refseq: NM_001143679
• Protein Refseq: NP_001137151
• MIM: 602321
• UniProt ID: Q9Y2Q3