Recombinant Human GSPT1 protein, GST-tagged

Description :	GSPT1 played an important role in many functions.
Source :	Wheat Germ
Species :	Human
Tag :	GST
Form :	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass :	37.84 kDa
AA Sequence :	GRTFDAQIVIIEHKSIICPGYNAVLHIHTCIEEVEITALICLVDKKSGEKSKTRPRFVKQDQVCIARLRTAGTIC LETFKDFPQMGRFTLRDEGKTIAIGKVLKLVPEKD
Applications :	Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes :	Best use within three months from the date of receipt of this protein.
Storage :	Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Protein length :	390-499 a.a.

Gene Name	GSPT1 G1 to S phase transition 1 [ Homo sapiens ]
Official Symbol	GSPT1
Synonyms	GSPT1; G1 to S phase transition 1; eukaryotic peptide chain release factor GTP-binding subunit ERF3A; eRF3a; ETF3A; GST1; G1 to S phase transition protein 1 homolog; eukaryotic peptide chain release factor subunit 3a; 551G9.2; FLJ38048; FLJ39067;
Gene ID	2935
mRNA Refseq	NM_002094
Protein Refseq	NP_002085
MIM	139259
UniProt ID	P15170
Chromosome Location	16p13.1
Pathway	mRNA surveillance pathway, organism-specific biosystem; mRNA surveillance pathway, conserved biosystem;
Function	GTP binding; GTPase activity; nucleotide binding; protein binding; translation release factor activity;