Recombinant Human GSPT1 protein, GST-tagged

• Cat.No.: GSPT1-909H
• Product Overview: Recombinant Human GSPT1(390 a.a. - 499 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 390-499 a.a.
• Description: GSPT1 played an important role in many functions.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 37.84 kDa
• AA Sequence: GRTFDAQIVIIEHKSIICPGYNAVLHIHTCIEEVEITALICLVDKKSGEKSKTRPRFVKQDQVCIARLRTAGTIC LETFKDFPQMGRFTLRDEGKTIAIGKVLKLVPEKD
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: GSPT1 G1 to S phase transition 1 [ Homo sapiens ]
• Official Symbol: GSPT1
• Synonyms: GSPT1; G1 to S phase transition 1; eukaryotic peptide chain release factor GTP-binding subunit ERF3A; eRF3a; ETF3A; GST1; G1 to S phase transition protein 1 homolog; eukaryotic peptide chain release factor subunit 3a; 551G9.2; FLJ38048; FLJ39067
• Gene ID: 2935
• mRNA Refseq: NM_002094
• Protein Refseq: NP_002085
• MIM: 139259
• UniProt ID: P15170
• Chromosome Location: 16p13.1
• Pathway: mRNA surveillance pathway, organism-specific biosystem; mRNA surveillance pathway, conserved biosystem
• Function: GTP binding; GTPase activity; nucleotide binding; protein binding; translation release factor activity