Recombinant Human GRIA1 Protein, GST-tagged

Description :	Glutamate receptors are the predominant excitatory neurotransmitter receptors in the mammalian brain and are activated in a variety of normal neurophysiologic processes. These receptors are heteromeric protein complexes with multiple subunits, each possessing transmembrane regions, and all arranged to form a ligand-gated ion channel. The classification of glutamate receptors is based on their activation by different pharmacologic agonists. This gene belongs to a family of alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate (AMPA) receptors. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Source :	Wheat Germ
Species :	Human
Tag :	GST
Molecular Mass :	36.74 kDa
AA Sequence :	VVDCESERLNAILGQIIKLEKNGIGYHYILANLGFMDIDLNKFKESGANVTGFQLVNYTDTIPAKIMQQWKNSDARDHTRVDWKRPKYTSALTYDGVKVM
Applications :	Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array
Notes :	Best use within three months from the date of receipt of this protein.
Storage :	Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer :	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Name	GRIA1 glutamate receptor, ionotropic, AMPA 1 [ Homo sapiens ]
Official Symbol	GRIA1
Synonyms	GRIA1; glutamate receptor, ionotropic, AMPA 1; GLUR1; glutamate receptor 1; GluA1; GLURA; AMPA 1; gluR-1; gluR-A; gluR-K1; AMPA-selective glutamate receptor 1; GLUH1; HBGR1; MGC133252;
Gene ID	2890
mRNA Refseq	NM_000827
Protein Refseq	NP_000818
MIM	138248
UniProt ID	P42261