Recombinant Human GRB2 protein, T7/His-tagged

Cat.No. : GRB2-127H
Product Overview : Recombinant human GRB2 cDNA (2 – 217 aa) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Protein Length : 2-217 a.a.
Form : 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence : MASMTGGQQMGRGHHHHHHENLYFQGGSEAIAKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFI PKNYIEMKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVV KFNSLNELVDYHRSTSVSRNQQIFLRDIEQVPQQPTYVQALFDFDPQEDGELGFRRGDFIHVMDNSDPNWWKGAC HGQTGMFPRNYVTPVNRNV
Purity : >90% by SDS-PAGE
Applications : 1. May be used for in vitro protein mediated Wnt / b-catenin pathway regulation study in tumor cell transformation or ES cell differentiation with this protein as either coating matrix protein or soluble factor.2. May be used for GRB2 protein-protein interaction assay.3. Enzymatic substrate for various proteases.4. As antigen for specific antibody production.
Storage : Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Gene Name GRB2 growth factor receptor-bound protein 2 [ Homo sapiens ]
Official Symbol GRB2
Synonyms GRB2; growth factor receptor-bound protein 2; NCKAP2; HT027; protein Ash; SH2/SH3 adapter GRB2; abundant SRC homology; growth factor receptor-bound protein 3; epidermal growth factor receptor-binding protein GRB2; ASH; Grb3-3; MST084; MSTP084; EGFRBP-GRB2;
Gene ID 2885
mRNA Refseq NM_002086
Protein Refseq NP_002077
MIM 108355
UniProt ID P62993
Chromosome Location 17q24-q25
Pathway Acute myeloid leukemia, organism-specific biosystem; Acute myeloid leukemia, conserved biosystem; Adaptive Immune System, organism-specific biosystem; Alpha6-Beta4 Integrin Signaling Pathway, organism-specific biosystem; Angiopoietin receptor Tie2-mediated signaling, organism-specific biosystem; Antigen Activates B Cell Receptor Leading to Generation of Second Messengers, organism-specific biosystem; Axon guidance, organism-specific biosystem;
Function SH3/SH2 adaptor activity; ephrin receptor binding; epidermal growth factor receptor binding; insulin receptor substrate binding; neurotrophin TRKA receptor binding; phosphoprotein binding; phosphotyrosine binding; protein binding; protein domain specific

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All GRB2 Products

Required fields are marked with *

My Review for All GRB2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon