Recombinant Human GRB2 protein, T7/His-tagged

Source :	E. coli
Species :	Human
Tag :	His&T7
Form :	0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence :	MASMTGGQQMGRGHHHHHHENLYFQGGSEAIAKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFI PKNYIEMKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVV KFNSLNELVDYHRSTSVSRNQQIFLRDIEQVPQQPTYVQALFDFDPQEDGELGFRRGDFIHVMDNSDPNWWKGAC HGQTGMFPRNYVTPVNRNV
Purity :	>90% by SDS-PAGE
Applications :	1. May be used for in vitro protein mediated Wnt / b-catenin pathway regulation study in tumor cell transformation or ES cell differentiation with this protein as either coating matrix protein or soluble factor.2. May be used for GRB2 protein-protein interaction assay.3. Enzymatic substrate for various proteases.4. As antigen for specific antibody production.
Storage :	Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Protein length :	2-217 a.a.

Gene Name	GRB2 growth factor receptor-bound protein 2 [ Homo sapiens ]
Official Symbol	GRB2
Synonyms	GRB2; growth factor receptor-bound protein 2; NCKAP2; HT027; protein Ash; SH2/SH3 adapter GRB2; abundant SRC homology; growth factor receptor-bound protein 3; epidermal growth factor receptor-binding protein GRB2; ASH; Grb3-3; MST084; MSTP084; EGFRBP-GRB2;
Gene ID	2885
mRNA Refseq	NM_002086
Protein Refseq	NP_002077
MIM	108355
UniProt ID	P62993
Chromosome Location	17q24-q25
Pathway	Acute myeloid leukemia, organism-specific biosystem; Acute myeloid leukemia, conserved biosystem; Adaptive Immune System, organism-specific biosystem; Alpha6-Beta4 Integrin Signaling Pathway, organism-specific biosystem; Angiopoietin receptor Tie2-mediated signaling, organism-specific biosystem; Antigen Activates B Cell Receptor Leading to Generation of Second Messengers, organism-specific biosystem; Axon guidance, organism-specific biosystem;
Function	SH3/SH2 adaptor activity; ephrin receptor binding; epidermal growth factor receptor binding; insulin receptor substrate binding; neurotrophin TRKA receptor binding; phosphoprotein binding; phosphotyrosine binding; protein binding; protein domain specific

COA

Cat.No. :	GRB2-127H
Product Overview :	Recombinant human GRB2 cDNA (2 – 217 aa) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.