Recombinant Human GRAMD2A Protein

• Cat.No.: GRAMD2A-5030H
• Product Overview: Human GRAMD2 full-length ORF (AAI60185.1) recombinant protein without tag.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Description: GRAMD2A (GRAM Domain Containing 2A) is a Protein Coding gene. An important paralog of this gene is GRAMD2B.
• Form: Liquid
• Molecular Mass: 39 kDa
• AA Sequence: MTALSRSEATEEGGNQQMHRKTASLNSPVSCKEKPDRVEEPPDYSLHWPEGLKGEEIKKCGREGITLNKYNQQYHKLFKDVPLEEVVLKVCSCALQRDFLLQGRLYISPNWLCFHASLFGKDIKVVIPVVSVQMIKKHKMARLLPNGLAITTNTSQKYIFVSLLSRDSVYDLLRRVCTHLQPSSKKSLSVREFSGEPESLEVLIPEMKWRKVCPSSRSLSLPDNIPCIPPSSVDSTDSFFPSRKPPMSEKSRAQVASENGGRWAWPMPGWGPACPKKMPNCSPTAKNAVYEEDELEEEPRSTGELRLWDYRLLKVFFVLICFLVMSSSYLAFRISRLEQQLCSLSWDDPVPGHR
• Applications: Antibody Production
  Functional Study
  Compound Screening
• Usage: Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.

Gene Information

• Gene Name: GRAMD2A GRAM domain containing 2A [ Homo sapiens (human) ]
• Official Symbol: GRAMD2A
• Synonyms: GRAMD2; GRAM domain containing 2; GRAM domain-containing protein 2
• Gene ID: 196996
• mRNA Refseq: NM_001012642
• Protein Refseq: NP_001012660
• UniProt ID: Q8IUY3