Recombinant Human GPX7 Protein, GST-tagged

• Cat.No.: GPX7-5314H
• Product Overview: Human GPX7 full-length ORF ( NP_056511.2, 1 a.a. - 187 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: GPX7 (Glutathione Peroxidase 7) is a Protein Coding gene. Diseases associated with GPX7 include Childhood Kidney Cell Carcinoma. Among its related pathways are Glutathione metabolism and Cellular Senescence. GO annotations related to this gene include oxidoreductase activity and peroxidase activity. An important paralog of this gene is GPX8.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 47.4 kDa
• AA Sequence: MVAATVAAAWLLLWAAACAQQEQDFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFTDQHYRALQQLQRDLGPHHFNVLAFPCNQFGQQEPDSNKEIESFARRTYSVSFPMFSKIAVTGTGAHPAFKYLAQTSGKEPTWNFWKYLVAPDGKVVGAWDPTVSVEEVRPQITALVRKLILLKREDL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GPX7 glutathione peroxidase 7 [ Homo sapiens ]
• Official Symbol: GPX7
• Synonyms: GPX7; glutathione peroxidase 7; FLJ14777; GPX6; NPGPx; glutathione peroxidase 6; non-selenocysteine containing phospholipid hydroperoxide glutathione peroxidase; CL683; GPx-7; GSHPx-7
• Gene ID: 2882
• mRNA Refseq: NM_015696
• Protein Refseq: NP_056511
• MIM: 615784
• UniProt ID: Q96SL4