Recombinant Human GPX7 Protein, GST-tagged
Cat.No. : | GPX7-5314H |
Product Overview : | Human GPX7 full-length ORF ( NP_056511.2, 1 a.a. - 187 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | GPX7 (Glutathione Peroxidase 7) is a Protein Coding gene. Diseases associated with GPX7 include Childhood Kidney Cell Carcinoma. Among its related pathways are Glutathione metabolism and Cellular Senescence. GO annotations related to this gene include oxidoreductase activity and peroxidase activity. An important paralog of this gene is GPX8. |
Molecular Mass : | 47.4 kDa |
AA Sequence : | MVAATVAAAWLLLWAAACAQQEQDFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFTDQHYRALQQLQRDLGPHHFNVLAFPCNQFGQQEPDSNKEIESFARRTYSVSFPMFSKIAVTGTGAHPAFKYLAQTSGKEPTWNFWKYLVAPDGKVVGAWDPTVSVEEVRPQITALVRKLILLKREDL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GPX7 glutathione peroxidase 7 [ Homo sapiens ] |
Official Symbol | GPX7 |
Synonyms | GPX7; glutathione peroxidase 7; FLJ14777; GPX6; NPGPx; glutathione peroxidase 6; non-selenocysteine containing phospholipid hydroperoxide glutathione peroxidase; CL683; GPx-7; GSHPx-7; |
Gene ID | 2882 |
mRNA Refseq | NM_015696 |
Protein Refseq | NP_056511 |
MIM | 615784 |
UniProt ID | Q96SL4 |
◆ Recombinant Proteins | ||
GPX7-1787R | Recombinant Rhesus Macaque GPX7 Protein, His (Fc)-Avi-tagged | +Inquiry |
GPX7-2234H | Recombinant Human GPX7 Protein, MYC/DDK-tagged | +Inquiry |
GPX7-3975C | Recombinant Chicken GPX7 | +Inquiry |
GPX7-13511H | Recombinant Human GPX7, GST-tagged | +Inquiry |
GPX7-1391H | Recombinant Human Glutathione Peroxidase 7, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GPX7-1528HCL | Recombinant Human GPX7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GPX7 Products
Required fields are marked with *
My Review for All GPX7 Products
Required fields are marked with *
0
Inquiry Basket