Recombinant Human GPS1 protein(91-170 aa), C-His-tagged

• Cat.No.: GPS1-2843H
• Product Overview: Recombinant Human GPS1 protein(Q13098)(91-170 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 91-170 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: YEEIHRKLSEATRSSLRELQNAPDAIPESGVEPPALDTAWVEATRKKALLKLEKLDTDLKNYKGNSIKESIRRGHDDLGD

Gene Information

• Gene Name: GPS1 G protein pathway suppressor 1 [ Homo sapiens ]
• Official Symbol: GPS1
• Synonyms: GPS1; G protein pathway suppressor 1; COP9 signalosome complex subunit 1; COPS1; CSN1; SGN1; GPS-1; signalosome subunit 1; JAB1-containing signalosome subunit 1; MGC71287
• Gene ID: 2873
• mRNA Refseq: NM_004127
• Protein Refseq: NP_004118
• MIM: 601934
• UniProt ID: Q13098