Name: Recombinant Human GPR84 protein
SKU: GPR84-51H

Species :	Human
Source :	Wheat Germ
Tag :	Non
Description :	GPR84 played an important role in many functions.
Form :	25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Molecular Mass :	43.7 kDa
AA Sequence :	MWNSSDANFSCYHESVLGYRYVAVSWGVVVAVTGTVGNVLTLLALAIQPKLRTRFNLLIANLTLADLLYCTLLQP FSVDTYLHLHWRTGATFCRVFGLLLFASNSVSILTLCLIALGRYLLIAHPKLFPQVFSAKGIVLALVSTWVVGVA SFAPLWPIYILVPVVCTCSFDRIRGRPYTTILMGIYFVLGLSSVGIFYCLIHRQVKRAAQALDQYKLRQASIHSN HVARTDEAMPGRFQELDSRLASGGPSEGISSEPVSAATTQTLEGDSSEVGDQINSKRAKQMAEKSPPEASAKAQP IKGARRAPDSSSEFGKVTRMCFAVFLCFALSYIPFLLLNILDARVQAPRVVHMLAANLTWLNGCINPVLYAAMNR QFRQAYGSILKRGPRSFHRLH
Applications :	Antibody Production Functional; Study Recommended usage: only, not validated yet; Compound Screening: Recommended usage only, not validated yet.
Notes :	Heating may cause protein aggregation. Please do not heat this product before electrophoresis. Best use within three months from the date of receipt of this protein.
Storage :	Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Name	GPR84 G protein-coupled receptor 84 [ Homo sapiens ]
Official Symbol	GPR84
Synonyms	GPR84; G protein-coupled receptor 84; G-protein coupled receptor 84; EX33; inflammation-related G protein-coupled receptor EX33; inflammation-related G-protein coupled receptor EX33; GPCR4;
Gene ID	53831
mRNA Refseq	NM_020370
Protein Refseq	NP_065103
MIM	606383
UniProt ID	Q9NQS5
Chromosome Location	12q13.13
Pathway	GPCRs, Other, organism-specific biosystem;
Function	G-protein coupled receptor activity; receptor activity; signal transducer activity;