Recombinant Human GPR176 Protein, GST-tagged

• Cat.No.: GPR176-5164H
• Product Overview: Human GPR partial ORF ( NP_009154, 416 a.a. - 515 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: Members of the G protein-coupled receptor family, such as GPR176, are cell surface receptors involved in responses to hormones, growth factors, and neurotransmitters (Hata et al., 1995 [PubMed 7893747]).[supplied by OMIM
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.74 kDa
• AA Sequence: PQFAPSAPPLSTVDSVSQVAPAAPVEPETFPDKYSLQFGFGPFELPPQWLSETRNSKKRLLPPLGNTPEELIQTKVPKVGRVERKMSRNNKVSIFPKVDS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GPR176 G protein-coupled receptor 176 [ Homo sapiens ]
• Official Symbol: GPR176
• Synonyms: GPR; Gm1012; GPR176; G protein-coupled receptor 176
• Gene ID: 11245
• mRNA Refseq: NM_007223
• Protein Refseq: NP_009154
• MIM: 612183
• UniProt ID: Q14439