Recombinant Human GPR107 protein, His&Myc-tagged

• Cat.No.: GPR107-5342H
• Product Overview: Recombinant Human GPR107 protein(Q5VW38)(40-263aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli.

Specification

• Source: E.coli
• Species: Human
• Tag: His&Myc
• Protein length: 40-263a.a.
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 32.4 kDa
• AASequence: RVHHLALKDDVRHKVHLNTFGFFKDGYMVVNVSSLSLNEPEDKDVTIGFSLDRTKNDGFSSYLDEDVNYCILKKQSVSVTLLILDISRSEVRVKSPPEAGTQLPKIIFSRDEKVLGQSQEPNVNPASAGNQTQKTQDGGKSKRSTVDSKAMGEKSFSVHNNGGAVSFQFFFNISTDDQEGLYSLYFHKCLGKELPSDKFTFSLDIEITEKNPDSYLSAGEIPLP
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: GPR107 G protein-coupled receptor 107 [ Homo sapiens ]
• Official Symbol: GPR107
• Synonyms: GPR107; G protein-coupled receptor 107; protein GPR107; FLJ20998; KIAA1624; LUSTR1; RP11 88G17; lung seven transmembrane receptor 1; GCDRP; bA138E2.2; RP11-88G17; FLJ16312; FLJ22591; MGC15440; MGC126118; DKFZp667C222
• Gene ID: 57720
• mRNA Refseq: NM_001136557
• Protein Refseq: NP_001130029
• UniProt ID: Q5VW38