Recombinant Human GPR107 protein, His&Myc-tagged
Cat.No. : | GPR107-5342H |
Product Overview : | Recombinant Human GPR107 protein(Q5VW38)(40-263aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Source : | E.coli |
Species : | Human |
Tag : | His&Myc |
Protein length : | 40-263a.a. |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 32.4 kDa |
AASequence : | RVHHLALKDDVRHKVHLNTFGFFKDGYMVVNVSSLSLNEPEDKDVTIGFSLDRTKNDGFSSYLDEDVNYCILKKQSVSVTLLILDISRSEVRVKSPPEAGTQLPKIIFSRDEKVLGQSQEPNVNPASAGNQTQKTQDGGKSKRSTVDSKAMGEKSFSVHNNGGAVSFQFFFNISTDDQEGLYSLYFHKCLGKELPSDKFTFSLDIEITEKNPDSYLSAGEIPLP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | GPR107 G protein-coupled receptor 107 [ Homo sapiens ] |
Official Symbol | GPR107 |
Synonyms | GPR107; G protein-coupled receptor 107; protein GPR107; FLJ20998; KIAA1624; LUSTR1; RP11 88G17; lung seven transmembrane receptor 1; GCDRP; bA138E2.2; RP11-88G17; FLJ16312; FLJ22591; MGC15440; MGC126118; DKFZp667C222; |
Gene ID | 57720 |
mRNA Refseq | NM_001136557 |
Protein Refseq | NP_001130029 |
UniProt ID | Q5VW38 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All GPR107 Products
Required fields are marked with *
My Review for All GPR107 Products
Required fields are marked with *
0
Inquiry Basket