Recombinant Human GPR1 Protein

• Cat.No.: GPR1-5165H
• Product Overview: Human GPR1 full-length ORF (NP_005270.2) recombinant protein without tag.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Description: GPR1 (G Protein-Coupled Receptor 1) is a Protein Coding gene. Among its related pathways are Peptide ligand-binding receptors. GO annotations related to this gene include G-protein coupled receptor activity and neuropeptide binding. An important paralog of this gene is CMKLR1.
• Form: Liquid
• Molecular Mass: 41.4 kDa
• AA Sequence: MEDLEETLFEEFENYSYDLDYYSLESDLEEKVQLGVVHWVSLVLYCLAFVLGIPGNAIVIWFTGFKWKKTVTTLWFLNLAIADFIFLLFLPLYISYVAMNFHWPFGIWLCKANSFTAQLNMFASVFFLTVISLDHYIHLIHPVLSHRHRTLKNSLIVIIFIWLLASLIGGPALYFRDTVEFNNHTLCYNNFQKHDPDLTLIRHHVLTWVKFIIGYLFPLLTMSICYLCLIFKVKKRSILISSRHFWTILVVVVAFVVCWTPYHLFSIWELTIHHNSYSHHVMQAGIPLSTGLAFLNSCLNPILYVLISKKFQARFRSSVAEILKYTLWEVSCSGTVSEQLRNSETKNLCLLETAQ
• Applications: Antibody Production
  Functional Study
  Compound Screening
• Usage: Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.

Gene Information

• Gene Name: GPR1 G protein-coupled receptor 1 [ Homo sapiens ]
• Official Symbol: GPR1
• Synonyms: GPR1 G; protein-coupled receptor 1
• Gene ID: 2825
• mRNA Refseq: NM_005279
• Protein Refseq: NP_005270
• MIM: 600239
• UniProt ID: P46091