Recombinant Human GPNMB protein, His-tagged
Cat.No. : | GPNMB-2980H |
Product Overview : | Recombinant Human GPNMB protein(38-158 aa), fused to His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 38-158 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MREHNQLNGWSSDENDWNEKLYPVWKRGDMRWKNSWKGGRVQAVLTSDSPALVGSNITFAVNLIFPRCQKEDANGNIVYEKNCRNEAGLSADPYVYNWTAWSEDSDGENGTGQSHHNVFPD |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | GPNMB glycoprotein (transmembrane) nmb [ Homo sapiens ] |
Official Symbol | GPNMB |
Synonyms | GPNMB; glycoprotein (transmembrane) nmb; transmembrane glycoprotein NMB; glycoprotein NMB; glycoprotein nmb like protein; HGFIN; NMB; osteoactivin; transmembrane glycoprotein; glycoprotein nmb-like protein; transmembrane glycoprotein HGFIN; |
Gene ID | 10457 |
mRNA Refseq | NM_001005340 |
Protein Refseq | NP_001005340 |
MIM | 604368 |
UniProt ID | Q14956 |
◆ Recombinant Proteins | ||
GPNMB-3783H | Recombinant Human GPNMB protein, His-tagged | +Inquiry |
GPNMB-01H | Recombinant Human GPNMB Protein, His-Tagged | +Inquiry |
GPNMB-1579H | Recombinant Human GPNMB Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
GPNMB-5162H | Recombinant Human GPNMB Protein, GST-tagged | +Inquiry |
Gpnmb-08M | Recombinant Mouse glycoprotein (transmembrane) nmb Protein, mIgG2a tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GPNMB-1886HCL | Recombinant Human GPNMB cell lysate | +Inquiry |
GPNMB-1423MCL | Recombinant Mouse GPNMB cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GPNMB Products
Required fields are marked with *
My Review for All GPNMB Products
Required fields are marked with *
0
Inquiry Basket